BYKdb

Annotate results for A0A143DFU4

A0A143DFU4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143DFU4
DOMAINtad12/188DDGAFDTILRLLWRRWRTVISPALVLMAMTLIAGAVMPRHYTATSVIMLDRGQPENVTGV
AGVNPALPREPVSILGEIEVLRSPALISALIKAEDLENDPEFVPALALQESTAWLDGFLA
ALKPEPDPIPAGASPALHTVRKAISVNQMNRALVIGISVSTREPAKSARLSNRLVEL
DOMAINcd522/719TSTLPGEGKTTLVYRLGQVLARSGRKVLLVDADLRRPALTPLATGNPVDPDHSSAPNLMS
VLAGTQTPESSIICLQQNSLFLLPGAIAGAAAPDLLEGPGFMSLLRYMQDNFDIVLLDAP
PVMPVADARVMARFCQTMLFAVRWESTPDDAIQQALELLDASGAGVPLMAVMTMIDLRKQ
ATYGYGGYRKHYSAYQEY
SITEWalker A529/531GKT
SITEWalker A'549/556LLVDADLR
SITEWalker B636/642VLLDAPP
SITEY Cluster704/722YGYGGYRKHYSAYQEYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGIQVTGQHRDDGAFDTILRLLWRRWRTVISPALVLMAMTLIAGAVMPRHYTATSVIMLDRGQPENVTGVAGVNPALPR
           DDGAFDTILRLLWRRWRTVISPALVLMAMTLIAGAVMPRHYTATSVIMLDRGQPENVTGVAGVNPALPR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPVSILGEIEVLRSPALISALIKAEDLENDPEFVPALALQESTAWLDGFLAALKPEPDPIPAGASPALHTVRKAISVNQM
EPVSILGEIEVLRSPALISALIKAEDLENDPEFVPALALQESTAWLDGFLAALKPEPDPIPAGASPALHTVRKAISVNQM

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRALVIGISVSTREPAKSARLSNRLVELYLEHQRQARTEAVMSVSSFLNDRLENLRQAVNEADAKVTVFRSTHGLGQNGE
NRALVIGISVSTREPAKSARLSNRLVEL                                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISLAAQQRTDLNNQLVQARTTRVSTEARLERLRLAANHDDLENMPDVLLSPTVQNLKAREAELSRTLADLNARYGEKHPY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRDTRAQLEDLRRRITSEAITILRSMENEASIARIRERSLTAELRDLENQRQTEGEAMIQLRELEREAETSRALYQTFMM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RMKETGSQAGLDIPDTRVVSRAPVPDRPGGTPRGALVIASFFVGLLPGLVLAILVERLDRKLRHPRDIPQKLGLHLAGLM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRETAAPRNTVPPGSTAEELRALIARVWPAGDAPGPSILGVTSTLPGEGKTTLVYRLGQVLARSGRKVLLVDADLRRPAL
                                         TSTLPGEGKTTLVYRLGQVLARSGRKVLLVDADLRRPAL
                                                GKT                 LLVDADLR    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPLATGNPVDPDHSSAPNLMSVLAGTQTPESSIICLQQNSLFLLPGAIAGAAAPDLLEGPGFMSLLRYMQDNFDIVLLDA
TPLATGNPVDPDHSSAPNLMSVLAGTQTPESSIICLQQNSLFLLPGAIAGAAAPDLLEGPGFMSLLRYMQDNFDIVLLDA
                                                                           VLLDA
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVMPVADARVMARFCQTMLFAVRWESTPDDAIQQALELLDASGAGVPLMAVMTMIDLRKQATYGYGGYRKHYSAYQEYY
PPVMPVADARVMARFCQTMLFAVRWESTPDDAIQQALELLDASGAGVPLMAVMTMIDLRKQATYGYGGYRKHYSAYQEY 
PP                                                             YGYGGYRKHYSAYQEYY
  
..
AY

AY

© 1998-2019