BYKdb

Annotate results for A0A143PCJ0

A0A143PCJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143PCJ0
DOMAINcd47/230TAEKPSAGKSTIASNLAITYAQAGYKTLIIDGDMRKPTLHYIFNKMNNHGLSSTIINNIK
LEDSIEETEIENLDILTSGPIPPNPSELIGSSNFNEIISTLKDRYNFIVLDTPPVNTVTD
AQIYSKYITHSILVIDAEKNNRTEITKAKSLLDRVDSKILGVVLNRTPKDKSSSYYAYYG
SEDK
SITEWalker A54/56GKS
SITEWalker A'74/81LIIDGDMR
SITEWalker B154/160IVLDTPP
SITE-66/-71YAQAGY
SITE-170/-173YSKY
SITEY Cluster221/225YYAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQKDNQKHQLITLHEPKSVISEKFRGIRSNLLFSSADETIKGIVVTAEKPSAGKSTIASNLAITYAQAGYKTLIIDGDM
                                              TAEKPSAGKSTIASNLAITYAQAGYKTLIIDGDM
                                                     GKS                 LIIDGDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTLHYIFNKMNNHGLSSTIINNIKLEDSIEETEIENLDILTSGPIPPNPSELIGSSNFNEIISTLKDRYNFIVLDTPP
RKPTLHYIFNKMNNHGLSSTIINNIKLEDSIEETEIENLDILTSGPIPPNPSELIGSSNFNEIISTLKDRYNFIVLDTPP
R                                                                        IVLDTPP
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNTVTDAQIYSKYITHSILVIDAEKNNRTEITKAKSLLDRVDSKILGVVLNRTPKDKSSSYYAYYGSEDK
VNTVTDAQIYSKYITHSILVIDAEKNNRTEITKAKSLLDRVDSKILGVVLNRTPKDKSSSYYAYYGSEDK
                                                            YYAYY     
© 1998-2019