BYKdb

Annotate results for A0A143PNR5

A0A143PNR5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143PNR5
DOMAINcd127/313ASAVPGEGKSLTAANVALTLTTSYSRKVLLIDADLRRPSLHGLFRAPETSGLSEGLDAAT
ASRVSAIQLSPLLALLPAGRPVENPVPLLTSERMGELVRDARQHFDWIVIDTPPVALLTD
ANLLTKECDGALLVIHANRTPYALVQKAVQALGKPKIFGVVLNRLEDHITVHSGYGKYGG
YYNDYGR
SITEWalker A134/136GKS
SITEWalker A'155/162LLIDADLR
SITEWalker B234/240IVIDTPP
SITEY Cluster301/311YGKYGGYYNDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIDEALRRARGEQPEHRATDFEADAPWEFAEGTSARARSGRPDARPETPNALIPEESGVPDEVTLPPASSATGAIPEG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLFVSLDGDERMVGAGLRQAVVEEYRKLASSLHQAQINHRLQVVLVASAVPGEGKSLTAANVALTLTTSYSRKVLLIDAD
                                              ASAVPGEGKSLTAANVALTLTTSYSRKVLLIDAD
                                                     GKS                  LLIDAD
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRPSLHGLFRAPETSGLSEGLDAATASRVSAIQLSPLLALLPAGRPVENPVPLLTSERMGELVRDARQHFDWIVIDTPP
LRRPSLHGLFRAPETSGLSEGLDAATASRVSAIQLSPLLALLPAGRPVENPVPLLTSERMGELVRDARQHFDWIVIDTPP
LR                                                                       IVIDTPP
       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
VALLTDANLLTKECDGALLVIHANRTPYALVQKAVQALGKPKIFGVVLNRLEDHITVHSGYGKYGGYYNDYGRGGQ
VALLTDANLLTKECDGALLVIHANRTPYALVQKAVQALGKPKIFGVVLNRLEDHITVHSGYGKYGGYYNDYGR   
                                                            YGKYGGYYNDY     
© 1998-2019