BYKdb

Annotate results for A0A143PXU3

A0A143PXU3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143PXU3
DOMAINcd119/303TSPAPGDGKSHVAVNLALTLSESYRRKVLLVDADMRRPTLHHLFHVSGAHGLLDALRAEA
EDVPAVVPVTGTLSLLPAGRPQANPVGDLSSGRMSRLIANAGSTYDWVIVDSPPAAGLAD
ARIILETVDGAILVVRAAATRFAELQAATDALGPGRLLGVILNAVDPREIHREDYYGNYY
GYGSK
SITEWalker A126/128GKS
SITEWalker A'147/154LLVDADMR
SITEWalker B226/232VIVDSPP
SITEY Cluster293/300YYGNYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIDDALRRARGEQPEQAATDADIDMPWQFADSPAAPPRASHPPEQRPTSAPARVPEVARVDVKPLPEQVQRSVDDVPT


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARLVSAADANPVLIEQFRNLAAALNRLQTERTLKSLLVTSPAPGDGKSHVAVNLALTLSESYRRKVLLVDADMRRPTLHH
                                      TSPAPGDGKSHVAVNLALTLSESYRRKVLLVDADMRRPTLHH
                                             GKS                  LLVDADMR      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFHVSGAHGLLDALRAEAEDVPAVVPVTGTLSLLPAGRPQANPVGDLSSGRMSRLIANAGSTYDWVIVDSPPAAGLADAR
LFHVSGAHGLLDALRAEAEDVPAVVPVTGTLSLLPAGRPQANPVGDLSSGRMSRLIANAGSTYDWVIVDSPPAAGLADAR
                                                                 VIVDSPP        
       250       260       270       280       290       300   
....:....|....:....|....:....|....:....|....:....|....:....|...
IILETVDGAILVVRAAATRFAELQAATDALGPGRLLGVILNAVDPREIHREDYYGNYYGYGSK
IILETVDGAILVVRAAATRFAELQAATDALGPGRLLGVILNAVDPREIHREDYYGNYYGYGSK
                                                    YYGNYYGY   
© 1998-2019