BYKdb

Annotate results for A0A143PZ28

A0A143PZ28 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143PZ28
DOMAINcd58/249TSANVSEGKSTVTDNVAVVWAQTGQRVLLIDADLRRPTLHATFNKSNREGLTTILTSSDN
SVDLRKIVQPSGVESLDILTSGPIPPNPAELLNSQRMKTLIESVKSIYDMVIVDVPPLLE
VTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGY
GYGYGYGTDSAQ
SITEWalker A65/67GKS
SITEWalker A'85/92LLIDADLR
SITEWalker B168/174VIVDVPP
SITEY Cluster235/243YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSIFHRKKSNANNDTMNNGAKLITVAQPKSPISEQFRTIRTNINFMAIDKPIKTLALTSANVSEGKSTVTDNVAVVWAQT
                                                         TSANVSEGKSTVTDNVAVVWAQT
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSSDNSVDLRKIVQPSGVESLDILTSGPIPPNPAELLNSQRMKTLIES
GQRVLLIDADLRRPTLHATFNKSNREGLTTILTSSDNSVDLRKIVQPSGVESLDILTSGPIPPNPAELLNSQRMKTLIES
    LLIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
VKSIYDMVIVDVPPLLEVTDTQVLSHFLDAIVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNTDGDAGYGYGYG
       VIVDVPP                                                            YGYGYG
         
....:....
YGYGTDSAQ
YGYGTDSAQ
YGY      
© 1998-2019