BYKdb

Annotate results for A0A143Q1W1

A0A143Q1W1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143Q1W1
DOMAINcd57/246TSANMSEGKSTVTYNVAVVWAQTGQRVLLIDSDLRQPTLHATFNKSNQHGLTTILTSGTN
SVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLE
VTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNADGDAAYGY
GYGYGTDGDD
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDSDLR
SITEWalker B167/173VIVDVPP
SITEY Cluster234/240YGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFKRKQQHSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANMSEGKSTVTYNVAVVWAQTG
                                                        TSANMSEGKSTVTYNVAVVWAQTG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRVLLIDSDLRQPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTV
QRVLLIDSDLRQPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTSGPIPPNPAELLNSQRMKTLLDTV
   LLIDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQGQTQKLAVKRTVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
      VIVDVPP                                                            YGYGYGY
       
....:..
GTDGDDK
GTDGDD 

© 1998-2019