BYKdb

Annotate results for A0A143WJS1

A0A143WJS1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143WJS1
DOMAINtad21/201QQVSPLHAFSIMGRHRLAIALVTLGIAVPAGIGIFSLRPYYNASSILIIGTHQAPFRDLQ
ATVSSPEVDTVAVNSEVSILRSPAIARAVAQKLDLVNDPDFREALDHVPISKRMIDAISR
MFVTPPPQIPMTADERLQATSLLLNQWVTVLNDGRSYIITITASTVNAATSARIANAYAD
V
DOMAINcd554/741TSAEQAEGKTTFALSLAANTGRCGQRALVIDCDMRNPSAMRIMGAVSIVRNTHAPVSPLL
AGLERDVLPGVDILTPEGMMHRGGGAMLLPEELGQILAQVGSHYDMILLDTPPALAFPDA
AVLSRLTDGVVMVVKWGRTSAATLVQAMRTLHTYDARTLGAVLTQAPPHSLGEAERHPFR
IYSHYGLL
SITEWalker A561/563GKT
SITEWalker A'581/588LVIDCDMR
SITEWalker B660/666ILLDTPP
SITEY Cluster735/738YSHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNTLQLPASFNGPAPEPTATQQVSPLHAFSIMGRHRLAIALVTLGIAVPAGIGIFSLRPYYNASSILIIGTHQAPFRDLQ
                    QQVSPLHAFSIMGRHRLAIALVTLGIAVPAGIGIFSLRPYYNASSILIIGTHQAPFRDLQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATVSSPEVDTVAVNSEVSILRSPAIARAVAQKLDLVNDPDFREALDHVPISKRMIDAISRMFVTPPPQIPMTADERLQAT
ATVSSPEVDTVAVNSEVSILRSPAIARAVAQKLDLVNDPDFREALDHVPISKRMIDAISRMFVTPPPQIPMTADERLQAT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLLNQWVTVLNDGRSYIITITASTVNAATSARIANAYADVYLDFKRHMKISATWQANALLDEQIAPLRERLRKAEQAVQ
SLLLNQWVTVLNDGRSYIITITASTVNAATSARIANAYADV                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFREKNGLIAAELERAPGANGNSNADGGGTTVTDQQLIQMNRELITARGDLESRRARYTEIRNAIHNGSLDSIPDAVSSP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIQQLQAQEAQISSRAASLSQTVMDGNPDLQSVRAAAAQVRARIGAEIQRVASSAAKELSSAEARVAALSAEVDRLQGQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAENEADVTLRQLQSEATAARTVYQDYLGRFAQTSTQAELQVAEADLISRAETPLGPYGPPRKQYMLIAFIFALMMGAGS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALVIDRMRKGVRSTAELDAIPGLFALGLVPAFAGSLSRQYASRDRSAYLETVESIRSVLSFGHSRFRAKVVLVTSAEQAE
                                                                         TSAEQAE

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKTTFALSLAANTGRCGQRALVIDCDMRNPSAMRIMGAVSIVRNTHAPVSPLLAGLERDVLPGVDILTPEGMMHRGGGAM
GKTTFALSLAANTGRCGQRALVIDCDMRNPSAMRIMGAVSIVRNTHAPVSPLLAGLERDVLPGVDILTPEGMMHRGGGAM
GKT                 LVIDCDMR                                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLPEELGQILAQVGSHYDMILLDTPPALAFPDAAVLSRLTDGVVMVVKWGRTSAATLVQAMRTLHTYDARTLGAVLTQAP
LLPEELGQILAQVGSHYDMILLDTPPALAFPDAAVLSRLTDGVVMVVKWGRTSAATLVQAMRTLHTYDARTLGAVLTQAP
                   ILLDTPP                                                      
       730       740    
....:....|....:....|....
PHSLGEAERHPFRIYSHYGLLPPT
PHSLGEAERHPFRIYSHYGLL   
              YSHY      

© 1998-2019