BYKdb

Annotate results for A0A143WVN6

A0A143WVN6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143WVN6
DOMAINtad6/137DDIDFRSIVLDLIKNIWVIILAVLAVRMGISGYYELTYEPQYTSTATLAVTARGSSNGSY
SSLTTAMNMADVFSEVFQSDALKKMIEADIGESNIQGTINSSIISQTNLITLTVTSDTPA
HAYQMIQSALDN
DOMAINcd273/464CSVAENEGKSSVASNIALALADRHKKVLLVDGDLRKPALHRIFDLHDQVKYSLSEYLLGQ
CSFEQVITEVPNGLQIICQTRGLNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGV
DVEAILNYGDTSIMTVRQDWSEIGAINDFSDLLKQNDKEFMGFVLNAFHENILIEKSYGQ
YPYQNYQSRSVR
SITEWalker A280/282GKS
SITEWalker A'300/307LLVDGDLR
SITEWalker B381/387IVLDTPP
SITE-323/-328YSLSEY
SITEY Cluster450/458YGQYPYQNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEFQIDDIDFRSIVLDLIKNIWVIILAVLAVRMGISGYYELTYEPQYTSTATLAVTARGSSNGSYSSLTTAMNMADVFSE
     DDIDFRSIVLDLIKNIWVIILAVLAVRMGISGYYELTYEPQYTSTATLAVTARGSSNGSYSSLTTAMNMADVFSE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFQSDALKKMIEADIGESNIQGTINSSIISQTNLITLTVTSDTPAHAYQMIQSALDNYSSVSDYLFSNASLQMVREPNVP
VFQSDALKKMIEADIGESNIQGTINSSIISQTNLITLTVTSDTPAHAYQMIQSALDN                       

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGPSNYVNYLRIQRMATLAAGGLTAAVIVLVSILRPTVKRKSSARRQLDGRILATIPYERKYKSIHEYLHKPKKSVLISS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLLSMSFTESNRKLATLIERHMTRHQQKVLLVCSVAENEGKSSVASNIALALADRHKKVLLVDGDLRKPALHRIFDLHDQ
                                CSVAENEGKSSVASNIALALADRHKKVLLVDGDLRKPALHRIFDLHDQ
                                       GKS                 LLVDGDLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKYSLSEYLLGQCSFEQVITEVPNGLQIICQTRGLNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGVDVEAILNY
VKYSLSEYLLGQCSFEQVITEVPNGLQIICQTRGLNNSTKYIMSKNMLDFILKCRENYDLIVLDTPPIGAGVDVEAILNY
                                                            IVLDTPP             
       410       420       430       440       450       460        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
GDTSIMTVRQDWSEIGAINDFSDLLKQNDKEFMGFVLNAFHENILIEKSYGQYPYQNYQSRSVRKAEE
GDTSIMTVRQDWSEIGAINDFSDLLKQNDKEFMGFVLNAFHENILIEKSYGQYPYQNYQSRSVR    
                                                 YGQYPYQNY          
© 1998-2019