BYKdb

Annotate results for A0A143WVN9

A0A143WVN9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143WVN9
DOMAINtad12/152VEIDLWVLFRDFFMGCVKFWWLVVLLAVIGAASMLFKDTGFYTPMYRSQATFTVTTNTSE
DSNASYNFYYDSATAQQLSLTFPYILSSDLLTDAIMEDMGTTSINGSISASVISDSNMIT
MSVISSDPQAAHDILESAIKV
DOMAINcd285/473TSTVSGEGKSLISLNLAYELAKNKRHVLLIDADLRKQDLREQLHLPTDGEGLESLQDGVE
AAVKSINYLEDSGIYFLGGSHISKDPSGLLSSKEMDTFMKYMKEYMDFVIIDAPPCEGFE
DALILENYADGVLYIVKQDYVQKRRIIDSISMLAETQADLIGYVFNGVSHMMRGYGYGHY
GSYGYYQRY
SITEWalker A292/294GKS
SITEWalker A'312/319LLIDADLR
SITEWalker B393/399VIIDAPP
SITE-385/-424YMKEYMDFVIIDAPPCEGFEDALILENYADGVLYIVKQDY
SITE-477/-479GKS
SITEY Cluster459/482YGYGHYGSYGYYQRYGRYGKSYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEKELQQEEEVEIDLWVLFRDFFMGCVKFWWLVVLLAVIGAASMLFKDTGFYTPMYRSQATFTVTTNTSEDSNASYNFY
           VEIDLWVLFRDFFMGCVKFWWLVVLLAVIGAASMLFKDTGFYTPMYRSQATFTVTTNTSEDSNASYNFY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDSATAQQLSLTFPYILSSDLLTDAIMEDMGTTSINGSISASVISDSNMITMSVISSDPQAAHDILESAIKVYPDVARFV
YDSATAQQLSLTFPYILSSDLLTDAIMEDMGTTSINGSISASVISDSNMITMSVISSDPQAAHDILESAIKV        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IGPTRFNMIDAPTLPTEPYNQPHYTVNFAKGALIGAGIGFAFIIVYAFLRKTVHKEEELRQSINLKCIASIPNLKQKRRK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQRKQPLPSILDRRIDPYFIENMDSLYLRIMREMNERKGKTLLITSTVSGEGKSLISLNLAYELAKNKRHVLLIDADLRK
                                            TSTVSGEGKSLISLNLAYELAKNKRHVLLIDADLRK
                                                   GKS                 LLIDADLR 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDLREQLHLPTDGEGLESLQDGVEAAVKSINYLEDSGIYFLGGSHISKDPSGLLSSKEMDTFMKYMKEYMDFVIIDAPPC
QDLREQLHLPTDGEGLESLQDGVEAAVKSINYLEDSGIYFLGGSHISKDPSGLLSSKEMDTFMKYMKEYMDFVIIDAPPC
                                                                        VIIDAPP 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGFEDALILENYADGVLYIVKQDYVQKRRIIDSISMLAETQADLIGYVFNGVSHMMRGYGYGHYGSYGYYQRYGRYGKSY
EGFEDALILENYADGVLYIVKQDYVQKRRIIDSISMLAETQADLIGYVFNGVSHMMRGYGYGHYGSYGYYQRY       
                                                          YGYGHYGSYGYYQRYGRYGKSY
       490   
....:....|...
GYGHDQEKANAAE

GY           
© 1998-2019