BYKdb

Annotate results for A0A143X881

A0A143X881 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143X881
DOMAINcd40/222SSSSPNEGKTVTAFNLAYQFAKLGKRVVLVDADMRRSSLRSYLMLKDKVSGLSEALSRQS
RNYLFPTNVDNLFVILSGKNPPNPSELLSSPIFDQLISALKENFDYVIIDTAPMAVSMDA
TIVGRKSDGLVMVIRNEMTRKKNLRRIRADLERNGVRLVGAVLNRVKKNQIDYGDYRYEK
YYE
SITEWalker A47/49GKT
SITEWalker A'67/74VLVDADMR
SITEWalker B146/152VIIDTAP
SITEY Cluster212/221YGDYRYEKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEQQIIEIRNISSSTNTDEAFRTLRTNLMYIDDLKVITISSSSPNEGKTVTAFNLAYQFAKLGKRVVLVDADMRRSSLRS
                                       SSSSPNEGKTVTAFNLAYQFAKLGKRVVLVDADMRRSSLRS
                                              GKT                 VLVDADMR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLMLKDKVSGLSEALSRQSRNYLFPTNVDNLFVILSGKNPPNPSELLSSPIFDQLISALKENFDYVIIDTAPMAVSMDAT
YLMLKDKVSGLSEALSRQSRNYLFPTNVDNLFVILSGKNPPNPSELLSSPIFDQLISALKENFDYVIIDTAPMAVSMDAT
                                                                 VIIDTAP        
       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
IVGRKSDGLVMVIRNEMTRKKNLRRIRADLERNGVRLVGAVLNRVKKNQIDYGDYRYEKYYE
IVGRKSDGLVMVIRNEMTRKKNLRRIRADLERNGVRLVGAVLNRVKKNQIDYGDYRYEKYYE
                                                   YGDYRYEKYY 
© 1998-2019