BYKdb

Annotate results for A0A143XF22

A0A143XF22 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143XF22
DOMAINtad37/175IEIDLVLLFKDFWKSFTRLWWVVLMLIFLGSGGFFAYNYFGYEPIYECGATFTVATGDGE
NGSYNFYYNSSTADQLSKTFPYILDSNFFRSTLLERLGKDRLNGSITSETIDNSNMVTMK
VHSPNPQDAREILDVALEI
DOMAINcd307/496SSTDSGEGKSTLAVNLGELFAAQGKKVLLIDGDLRKQEDAEIIGIRDGAGLQDVVIEDKE
ATEMVQKIKENGIWFLGSRRPVKQPASILSSFRVREFILAMKEEMDYVIIDTPPCEIFQD
AGILADYADNILYVVKYDYVSQRRVWEGISFLGGHSAKFLGYVFNSYPEFASEYGYGRYG
YGKYGYGRQS
SITEWalker A314/316GKS
SITEWalker A'334/341LLIDGDLR
SITEWalker B414/420VIIDTPP
SITE-433/-445YADNILYVVKYDY
SITEY Cluster468/503YVFNSYPEFASEYGYGRYGYGKYGYGRQSYGKRKIY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLFIKSGSRLVIVMKDMKEDRDMKEDRKGIKNREDEIEIDLVLLFKDFWKSFTRLWWVVLMLIFLGSGGFFAYNYFGYEP
                                    IEIDLVLLFKDFWKSFTRLWWVVLMLIFLGSGGFFAYNYFGYEP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IYECGATFTVATGDGENGSYNFYYNSSTADQLSKTFPYILDSNFFRSTLLERLGKDRLNGSITSETIDNSNMVTMKVHSP
IYECGATFTVATGDGENGSYNFYYNSSTADQLSKTFPYILDSNFFRSTLLERLGKDRLNGSITSETIDNSNMVTMKVHSP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPQDAREILDVALEIYPETARFVLGSIQFNLLDEPETPTKPYNQIGTRQSLVLGGGVGGLLGMFLLGLSAFFRKTVRTPE
NPQDAREILDVALEI                                                                 

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMNKITSLRCLASVPQVRFKARKKKKKQKIFVLDKRLSHSYRESLKALQLRLENSMKKNQGKVLLISSTDSGEGKSTLAV
                                                                  SSTDSGEGKSTLAV
                                                                         GKS    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLGELFAAQGKKVLLIDGDLRKQEDAEIIGIRDGAGLQDVVIEDKEATEMVQKIKENGIWFLGSRRPVKQPASILSSFRV
NLGELFAAQGKKVLLIDGDLRKQEDAEIIGIRDGAGLQDVVIEDKEATEMVQKIKENGIWFLGSRRPVKQPASILSSFRV
             LLIDGDLR                                                           
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REFILAMKEEMDYVIIDTPPCEIFQDAGILADYADNILYVVKYDYVSQRRVWEGISFLGGHSAKFLGYVFNSYPEFASEY
REFILAMKEEMDYVIIDTPPCEIFQDAGILADYADNILYVVKYDYVSQRRVWEGISFLGGHSAKFLGYVFNSYPEFASEY
             VIIDTPP                                               YVFNSYPEFASEY
       490       500       510 
....:....|....:....|....:....|.
GYGRYGYGKYGYGRQSYGKRKIYGEGGDEND
GYGRYGYGKYGYGRQS               
GYGRYGYGKYGYGRQSYGKRKIY        
© 1998-2019