BYKdb

Annotate results for A0A143XF26

A0A143XF26 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143XF26
DOMAINtad9/138DEISIRGLCLELFRNLWMILLIGAALWLGVTGLHNLTYKPQYTSYSTLVVILKGQDSAYS
SLSVAKQMADVFGIVFQSEVLREKIIEDTGENIQGTINCEPVSETNLLVLSSTCQNPRQA
YLFIHSALKH
DOMAINcd272/457TSISENEGKSTVAANIALALAEKHKKVLLVDSDLRKPAQYKVFEEDQKGRDSLNQLLKEK
GDWREKIYYNKISQLWELFQFHSVEEPAAVLSGAFLEKLAGEWKKEMDYIIMDCSPVSIS
TDAEHLMKMADTVLLVVRQDWSDVRVINDTVDMIWQSGCDFSGFVLNAFYKEWIQTGYSY
EGYERG
SITEWalker A279/281GKS
SITEWalker A'299/306LLVDSDLR
SITEWalker B381/387IIMDCSP
SITE-339/-340YY
SITEY Cluster449/454YSYEGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQELFRFDEISIRGLCLELFRNLWMILLIGAALWLGVTGLHNLTYKPQYTSYSTLVVILKGQDSAYSSLSVAKQMADVF
        DEISIRGLCLELFRNLWMILLIGAALWLGVTGLHNLTYKPQYTSYSTLVVILKGQDSAYSSLSVAKQMADVF

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIVFQSEVLREKIIEDTGENIQGTINCEPVSETNLLVLSSTCQNPRQAYLFIHSALKHYEEVAKDVFANATLQIVQEPEV
GIVFQSEVLREKIIEDTGENIQGTINCEPVSETNLLVLSSTCQNPRQAYLFIHSALKH                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSTPSNTSLFMDRRSLITGAGVVAMTAIMCLFYILRFTVKNLISARRLLDGKIRGVIPYERKRISGNRRWVKKALLLNSP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVSMDFAEASRRAETQIEYHMRRNQQKILLVTSISENEGKSTVAANIALALAEKHKKVLLVDSDLRKPAQYKVFEEDQKG
                               TSISENEGKSTVAANIALALAEKHKKVLLVDSDLRKPAQYKVFEEDQKG
                                      GKS                 LLVDSDLR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDSLNQLLKEKGDWREKIYYNKISQLWELFQFHSVEEPAAVLSGAFLEKLAGEWKKEMDYIIMDCSPVSISTDAEHLMKM
RDSLNQLLKEKGDWREKIYYNKISQLWELFQFHSVEEPAAVLSGAFLEKLAGEWKKEMDYIIMDCSPVSISTDAEHLMKM
                                                            IIMDCSP             
       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
ADTVLLVVRQDWSDVRVINDTVDMIWQSGCDFSGFVLNAFYKEWIQTGYSYEGYERG
ADTVLLVVRQDWSDVRVINDTVDMIWQSGCDFSGFVLNAFYKEWIQTGYSYEGYERG
                                                YSYEGY   
© 1998-2019