BYKdb

Annotate results for A0A143XH99

A0A143XH99 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143XH99
DOMAINcd40/231TSCQPSEGKSSVSVETAISMAQMGKKVLLIDADLRKSVMAAKYHIGSEVKGLSELLSGLA
TLEQVLCATTTENLHMIFSGPVPPNPAELLGGKQIQVLLENLRDVYDYIIIDSPPLGSVI
DSAVVAGFCDGAILVVAADRIKYSFAQGVKEQFEKSGCKILGAVLNRVEMKKSAYGKYYS
GHYGRYYGKSAS
SITE-227/-229GKS
SITEWalker A'67/74LLIDADLR
SITEWalker B148/154IIIDSPP
SITE-145/-147YDY
SITEY Cluster214/226YGKYYSGHYGRYY
SITEWalker A47/49GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKVDVTSKYSDNYQVNEAFKALRTNILFCGSDIKVIIVTSCQPSEGKSSVSVETAISMAQMGKKVLLIDADLRKSVMAA
                                       TSCQPSEGKSSVSVETAISMAQMGKKVLLIDADLRKSVMAA
                                              GKS                 LLIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYHIGSEVKGLSELLSGLATLEQVLCATTTENLHMIFSGPVPPNPAELLGGKQIQVLLENLRDVYDYIIIDSPPLGSVID
KYHIGSEVKGLSELLSGLATLEQVLCATTTENLHMIFSGPVPPNPAELLGGKQIQVLLENLRDVYDYIIIDSPPLGSVID
                                                                   IIIDSPP      
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
SAVVAGFCDGAILVVAADRIKYSFAQGVKEQFEKSGCKILGAVLNRVEMKKSAYGKYYSGHYGRYYGKSASPYK
SAVVAGFCDGAILVVAADRIKYSFAQGVKEQFEKSGCKILGAVLNRVEMKKSAYGKYYSGHYGRYYGKSAS   
                                                     YGKYYSGHYGRYY        
© 1998-2019