BYKdb

Annotate results for A0A143XN92

A0A143XN92 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143XN92
DOMAINtad12/143LKIDIRTMIKDVLRYSWLIVIMAISFSLIAYMIIDSSYKPKYTSSTTFIVTGKGLNNSIY
DNLLTAQDMTNRFKNIIDSNILKEKIAEVLSMDSFDAEAEAEIVPETNLMVLRVTADTSK
KAFQILRAIMEN
DOMAINcd279/466TSMMENEGKSTVAANLALEFAKMGKNVLLIDLDLRKPAQHDIFGRKGEQFVGIAEWLENK
IDLKEKIVRINNSNLFILFNSQPLQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALT
SDGESLAHIIKDTILVVRYDTMLAADLNEVADTLNEAGSRVIGGIFNNAYSNILERIGME
QYGRKTSY
SITEWalker A286/288GKS
SITEWalker A'306/313LLIDLDLR
SITEWalker B388/394ILIDTSP
SITEY Cluster460/466YGRKTSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKYRDTNEMELKIDIRTMIKDVLRYSWLIVIMAISFSLIAYMIIDSSYKPKYTSSTTFIVTGKGLNNSIYDNLLTAQDM
           LKIDIRTMIKDVLRYSWLIVIMAISFSLIAYMIIDSSYKPKYTSSTTFIVTGKGLNNSIYDNLLTAQDM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNRFKNIIDSNILKEKIAEVLSMDSFDAEAEAEIVPETNLMVLRVTADTSKKAFQILRAIMENYTVVSDYVVSNVILEVL
TNRFKNIIDSNILKEKIAEVLSMDSFDAEAEAEIVPETNLMVLRVTADTSKKAFQILRAIMEN                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEPQIPMAASNANQAEDIAKKAFWMSGTAVLALILFFSMKKDTIKSEEEFRKKLDIRYLGTIYHERKHKTIRSAIKRESV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NMLITNPILSRKYINSIEITAAKVRNRMDAKRIKTVMITSMMENEGKSTVAANLALEFAKMGKNVLLIDLDLRKPAQHDI
                                      TSMMENEGKSTVAANLALEFAKMGKNVLLIDLDLRKPAQHDI
                                             GKS                 LLIDLDLR       
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGRKGEQFVGIAEWLENKIDLKEKIVRINNSNLFILFNSQPLQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALTSD
FGRKGEQFVGIAEWLENKIDLKEKIVRINNSNLFILFNSQPLQNSLELMDYSSWKDWIKKMEQEMDYILIDTSPVALTSD
                                                                   ILIDTSP      
       410       420       430       440       450       460      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
GESLAHIIKDTILVVRYDTMLAADLNEVADTLNEAGSRVIGGIFNNAYSNILERIGMEQYGRKTSY
GESLAHIIKDTILVVRYDTMLAADLNEVADTLNEAGSRVIGGIFNNAYSNILERIGMEQYGRKTSY
                                                           YGRKTSY
© 1998-2019