BYKdb

Annotate results for A0A143XPH3

A0A143XPH3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A143XPH3
DOMAINcd296/490TSSLPNEGKSTIAVNLALSIASRGKKVLLIDGDLRAPSVYKYFTKEQMKKKKGLSDILLN
NGSIKDAVFSPSIQNLDVILGGERIEDPSEILAGEQLHLLLEEVKKSYDYIIFDSSPAAM
LSDTTAIAGIMDAVLFVIRQDYTKIQYAQEGLALLNESGILSLGCVMNYAEAGLNHYGYG
YYGSRYSKYRYSKYE
SITEWalker A303/305GKS
SITEWalker A'323/330LLIDGDLR
SITEWalker B406/412IIFDSSP
SITE-335/-337YKY
SITE-403/-442YDYIIFDSSPAAMLSDTTAIAGIMDAVLFVIRQDYTKIQY
SITEY Cluster472/493YGYGYYGSRYSKYRYSKYERYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQRRIEKRQVGQTMQIYDNETKTNDTQEYIDIVKVLDEIWTEFLRHLGSITILFFLVVILVCSYSWFGYEPMYEAYSTF


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVSSNQTTEADIALAARLANSFEHAFTDSGLRDKIVDELRMDWEDDFKVDVSATTLEDTNFITITVNSDDGIIAQTILEL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IEENYPDIAKQIVGNITLTSIDATGILTEPTNPFSWITIILQGSLAGLVVIVVILYIYVSNKKTIHSAGDIKRHLNASCI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTVPITSFKKRKKNADPLLVITNDRVQQSYKEAIHTLRIRIERVMEKEEKKVILVTSSLPNEGKSTIAVNLALSIASRGK
                                                       TSSLPNEGKSTIAVNLALSIASRGK
                                                              GKS               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLIDGDLRAPSVYKYFTKEQMKKKKGLSDILLNNGSIKDAVFSPSIQNLDVILGGERIEDPSEILAGEQLHLLLEEVK
KVLLIDGDLRAPSVYKYFTKEQMKKKKGLSDILLNNGSIKDAVFSPSIQNLDVILGGERIEDPSEILAGEQLHLLLEEVK
  LLIDGDLR                                                                      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSYDYIIFDSSPAAMLSDTTAIAGIMDAVLFVIRQDYTKIQYAQEGLALLNESGILSLGCVMNYAEAGLNHYGYGYYGSR
KSYDYIIFDSSPAAMLSDTTAIAGIMDAVLFVIRQDYTKIQYAQEGLALLNESGILSLGCVMNYAEAGLNHYGYGYYGSR
     IIFDSSP                                                           YGYGYYGSR
       490       
....:....|....:..
YSKYRYSKYERYYGKDN
YSKYRYSKYE       
YSKYRYSKYERYY    
© 1998-2019