BYKdb

Annotate results for A0A143XPI5

A0A143XPI5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143XPI5
DOMAINtad14/150ESIDIFYLFNNVWKGIRQFYWIFLIIISISTAAGYYYAKESYRPNYEAYASFAVDAGVSS
YSSSYYNSTTIKQLSATFPYILTSGALRQIVMNDLGLEEMNVNITASAVEETNLFRIETS
GRDPELVYEVLESVIKN
DOMAINcd282/471NSAIQGEGKTTIAVNLALVRALRGEKVLLIDADLRNPSVSQVLHLDTNKKEIADVLEGKL
SWKSALISEQETGLQLLAGTYRRDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTILS
DAIILAKKLDSVIMVIRYDYARVNQILRGSESLADTGISMIGYVLNAVESGIMSYGYYAY
RYGYYHKGYR
SITEWalker A289/291GKT
SITEWalker A'309/316LLIDADLR
SITEWalker B390/396VIVDAPP
SITE-419/-421YDY
SITEY Cluster456/473YGYYAYRYGYYHKGYRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEEYSREPQRSEESIDIFYLFNNVWKGIRQFYWIFLIIISISTAAGYYYAKESYRPNYEAYASFAVDAGVSSYSSSYYN
             ESIDIFYLFNNVWKGIRQFYWIFLIIISISTAAGYYYAKESYRPNYEAYASFAVDAGVSSYSSSYYN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STTIKQLSATFPYILTSGALRQIVMNDLGLEEMNVNITASAVEETNLFRIETSGRDPELVYEVLESVIKNYPEVAEYIIG
STTIKQLSATFPYILTSGALRQIVMNDLGLEEMNVNITASAVEETNLFRIETSGRDPELVYEVLESVIKN          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STKLVIVDDSGVPKEPSNQPNLKRMALNGCLAGIVLSGILLAVYALTRNTICGDEDVKKIMQIKSLGTLPTVKMKKRRKD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNMEVSLLNQKLSPSFMEGIRTLRIRVDAALQEVSAKTILVNSAIQGEGKTTIAVNLALVRALRGEKVLLIDADLRNPSV
                                         NSAIQGEGKTTIAVNLALVRALRGEKVLLIDADLRNPSV
                                                GKT                 LLIDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SQVLHLDTNKKEIADVLEGKLSWKSALISEQETGLQLLAGTYRRDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTIL
SQVLHLDTNKKEIADVLEGKLSWKSALISEQETGLQLLAGTYRRDNSAKLMESTYMEQLLEEAKEQFDCVIVDAPPCTIL
                                                                     VIVDAPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDAIILAKKLDSVIMVIRYDYARVNQILRGSESLADTGISMIGYVLNAVESGIMSYGYYAYRYGYYHKGYRYYSINNKDM
SDAIILAKKLDSVIMVIRYDYARVNQILRGSESLADTGISMIGYVLNAVESGIMSYGYYAYRYGYYHKGYR         
                                                       YGYYAYRYGYYHKGYRYY       
       490 
....:....|.
ELHNKSTSQEK


© 1998-2019