BYKdb

Annotate results for A0A143ZDV4

A0A143ZDV4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143ZDV4
DOMAINtad16/200SGIDLNEIISTIKRQWRIVALCGILMLFLGAAFAFTATPKYTASSTLFIDGDNKQIADQL
LSDGNRNSGYPTRDDDATVLSEVEILRSERVATLVVERLDLTNAPEFQKRTPSLVSTVVT
TLKSLVASDTAPKAEDVEALKQSVKEALMRNTSASRVGRTYILEVEYVSRSPETAAKIAN
AIVDA
DOMAINcd559/749VSVLPREGKSTVALNFAQHLAKQGSRTLLIDADLRNPGATRAIGANARSGLYEVLSESQA
VEDVLLTDVETGLVFLPTIIKQRILFSAELLSSDAMNDLLASFCKTFDYVVLDLPPLGPV
VDARAISSKIDSFLMIIEWGSTARRIVRTAVQTHPGIMRKCAGVILNKVDLSKVKLYLHQ
DENFYHNSRYG
SITEWalker A566/568GKS
SITEWalker A'586/593LLIDADLR
SITEWalker B668/674VVLDLPP
SITEY Cluster743/752YHNSRYGDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKAQTSEFLPSQNESGIDLNEIISTIKRQWRIVALCGILMLFLGAAFAFTATPKYTASSTLFIDGDNKQIADQLLSDGN
               SGIDLNEIISTIKRQWRIVALCGILMLFLGAAFAFTATPKYTASSTLFIDGDNKQIADQLLSDGN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNSGYPTRDDDATVLSEVEILRSERVATLVVERLDLTNAPEFQKRTPSLVSTVVTTLKSLVASDTAPKAEDVEALKQSVK
RNSGYPTRDDDATVLSEVEILRSERVATLVVERLDLTNAPEFQKRTPSLVSTVVTTLKSLVASDTAPKAEDVEALKQSVK

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EALMRNTSASRVGRTYILEVEYVSRSPETAAKIANAIVDAYLEDQYNSKFDATRRASDWLQTRIEALRQKSLDSDLLVQK
EALMRNTSASRVGRTYILEVEYVSRSPETAAKIANAIVDA                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRAEKGLIATGGELVSEQQLTQINTNLVKAQSAAADAKSKYDSVQAVVASGDIRSAVVGSLESPVINKLQQEALDVSRRE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEISKRFGREHYQAVLLRSKLQEYDEVMFKELRRIADTYRQEYEVASASQKALEGQVAAATSTSAVANDDLVQLREYERA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AETYKTLYETYLQRFQEASQRESFPVTAARVVTRAEPPQDASYPKRPLILALALVMGCGVGAAIGAYREFGERFFRTGEQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQKELSMEFIGQIPLEKHEAGGAKLDASRVGPRGVLSKSNLDRYIIDHPLSSFAETIRSAKIAADFKAGHKPGRVIGMVS
                                                                              VS

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLPREGKSTVALNFAQHLAKQGSRTLLIDADLRNPGATRAIGANARSGLYEVLSESQAVEDVLLTDVETGLVFLPTIIKQ
VLPREGKSTVALNFAQHLAKQGSRTLLIDADLRNPGATRAIGANARSGLYEVLSESQAVEDVLLTDVETGLVFLPTIIKQ
     GKS                 LLIDADLR                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RILFSAELLSSDAMNDLLASFCKTFDYVVLDLPPLGPVVDARAISSKIDSFLMIIEWGSTARRIVRTAVQTHPGIMRKCA
RILFSAELLSSDAMNDLLASFCKTFDYVVLDLPPLGPVVDARAISSKIDSFLMIIEWGSTARRIVRTAVQTHPGIMRKCA
                           VVLDLPP                                              
       730       740       750      
....:....|....:....|....:....|....:.
GVILNKVDLSKVKLYLHQDENFYHNSRYGDYYLETK
GVILNKVDLSKVKLYLHQDENFYHNSRYG       
                      YHNSRYGDYY    

© 1998-2019