BYKdb

Annotate results for A0A143ZUX1

A0A143ZUX1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A143ZUX1
DOMAINtad10/149PSPTTLRYFRQLKKSWWIPTILLVIFAVAGFLFAQLTYKPTYSSIGSFWLQIYSTNENDQ
TKLVMSDIQAATGLAQTYQYFLTGADTIDYVLEESGLDLNPSQVKKMVSISQATGSVLEL
KVTASDPETAYRLAVAYMGA
DOMAINcd287/480TSTLADEGKSTVAANLAIALAQKGKKVLLIDVDLRRPTQHNLFQQTTYRNKGLSDILTGS
VYPMDAIHHNEKYGVYILYSGKPTDQASELLGNDLMNEFFKIVEPNFDFIIIDTPPAHVV
SDAMTIRRFVDATILVVRQDFTPASTIRHTLEDLDSEETPVIGCVFNGVARPNRLLGYGR
YSSYYYDYRESDSS
SITEWalker A294/296GKS
SITEWalker A'314/321LLIDVDLR
SITEWalker B396/402IIIDTPP
SITE-359/-365YGVYILY
SITEY Cluster464/474YGRYSSYYYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYEQNTSATPSPTTLRYFRQLKKSWWIPTILLVIFAVAGFLFAQLTYKPTYSSIGSFWLQIYSTNENDQTKLVMSDIQAA
         PSPTTLRYFRQLKKSWWIPTILLVIFAVAGFLFAQLTYKPTYSSIGSFWLQIYSTNENDQTKLVMSDIQAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLAQTYQYFLTGADTIDYVLEESGLDLNPSQVKKMVSISQATGSVLELKVTASDPETAYRLAVAYMGAIDIVVNPKDDS
TGLAQTYQYFLTGADTIDYVLEESGLDLNPSQVKKMVSISQATGSVLELKVTASDPETAYRLAVAYMGA           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGSGTAFVNSVQKIQPRMPQGPNTDYKKILYPAAGALLGLAVGLFLVWVLTRVSHTIQSEDDVYDFLPVKLFASIPTIGS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSRSRKGNSSLLISPRSDFSYVEAYKSLRVRVESLAAERGYKKFIVTSTLADEGKSTVAANLAIALAQKGKKVLLIDVDL
                                              TSTLADEGKSTVAANLAIALAQKGKKVLLIDVDL
                                                     GKS                 LLIDVDL
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRPTQHNLFQQTTYRNKGLSDILTGSVYPMDAIHHNEKYGVYILYSGKPTDQASELLGNDLMNEFFKIVEPNFDFIIIDT
RRPTQHNLFQQTTYRNKGLSDILTGSVYPMDAIHHNEKYGVYILYSGKPTDQASELLGNDLMNEFFKIVEPNFDFIIIDT
R                                                                          IIIDT
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDLDSEETPVIGCVFNGVARPNRLLGYGRYSSYYYDYRESDSS
PPAHVVSDAMTIRRFVDATILVVRQDFTPASTIRHTLEDLDSEETPVIGCVFNGVARPNRLLGYGRYSSYYYDYRESDSS
PP                                                             YGRYSSYYYDY      
       490     
....:....|....:
QSQSSKKKQRITRNG


© 1998-2019