BYKdb

Annotate results for A0A146GCJ0

A0A146GCJ0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A146GCJ0
DOMAINtad26/182DLFDSERWFNLLRSKAWLIAAVAVVVVIGAAAYAFRLPKIYESRALLQVEQLAQKVVDIA
DVSQENPQSTDFLKTVVEALKSRKLLARVVKAEGLDKDPDFAPPRKDGSPYSEIELVDKL
AQKIDVQLIRGTRLVQIVVEDKNPEKAQKIAATFVKE
DOMAINcd568/760ASAIPQEGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDIDGLTDYLSGG
APLDQVVRKTDQDNLFLLPAGHRAPNPSELLGGSEFREMLAKLLLTYDRVVVDSAPVNAV
SDALLIASCVDTACLVVRAGKTPKKASLRAVKQLQKSGAKLAGFIFNRLPVGGRSAGYYY
YYYGGEYSKNSVY
SITE-707/-709GKT
SITEWalker A'595/602VVIDADLR
SITEWalker B677/683VVVDSAP
SITEY Cluster745/760YYYYYYGGEYSKNSVY
SITEWalker A575/577GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPKDDGENLTSKPAVNLSFRDDTHGDLFDSERWFNLLRSKAWLIAAVAVVVVIGAAAYAFRLPKIYESRALLQVEQLAQK
                         DLFDSERWFNLLRSKAWLIAAVAVVVVIGAAAYAFRLPKIYESRALLQVEQLAQK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVDIADVSQENPQSTDFLKTVVEALKSRKLLARVVKAEGLDKDPDFAPPRKDGSPYSEIELVDKLAQKIDVQLIRGTRLV
VVDIADVSQENPQSTDFLKTVVEALKSRKLLARVVKAEGLDKDPDFAPPRKDGSPYSEIELVDKLAQKIDVQLIRGTRLV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIVVEDKNPEKAQKIAATFVKEFFRENFDQKLALSRVANEFLQDEADKLKVKLEASERKLQAYREDNKAVSLEERQNIIV
QIVVEDKNPEKAQKIAATFVKE                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKLRELNSKVTEAKSKRLQLEADIDQLKRVEKGNLDALLAINSVSNLPQVALIREQLLNAEGDLAGLKERYLPKHPKYIA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASMRIANLRQSLATEATQASETLSRLYEAAKDSEVKLEAALQEQEAKALELNKVAIPYNVLQRDVESDRALYESVTKRLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETAITQGIEQAPYRVIEEPMVPNVPSKPRIKLILLVSLVAGLGLGVALVVVIDLLDASLRTVDEAESYLGLPALTAVPEQ


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSKSVGEQVAEAWNDKTLGSLPKDLAQKQVLEPLRRSLNRKEREAQLKKHPLIFVEDPSSMQAEAIRTLRTSISLLGKQD


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DRKTFLFASAIPQEGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDIDGLTDYLSGGAPLDQVVRKTDQD
       ASAIPQEGKSFTSLNFAHALAQKGLRTVVIDADLRRPRLKDDLLPDAGDIDGLTDYLSGGAPLDQVVRKTDQD
              GKS                 VVIDADLR                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLFLLPAGHRAPNPSELLGGSEFREMLAKLLLTYDRVVVDSAPVNAVSDALLIASCVDTACLVVRAGKTPKKASLRAVKQ
NLFLLPAGHRAPNPSELLGGSEFREMLAKLLLTYDRVVVDSAPVNAVSDALLIASCVDTACLVVRAGKTPKKASLRAVKQ
                                    VVVDSAP                                     
       730       740       750       760     
....:....|....:....|....:....|....:....|....:
LQKSGAKLAGFIFNRLPVGGRSAGYYYYYYGGEYSKNSVYGEKSV
LQKSGAKLAGFIFNRLPVGGRSAGYYYYYYGGEYSKNSVY     
                        YYYYYYGGEYSKNSVY     

© 1998-2019