BYKdb

Annotate results for A0A147DUP0

A0A147DUP0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147DUP0
DOMAINtad1/135MTPLFRALLSRWYIVVAGILLGCVAAMALSATVTPQYRATTKLWVSVGGDAETSALELAQ
GSNAAQQRIRSYLDLVSQPIVLDPVIEELGLSTSAGALAGAVSATSPTGSVVMEISVTSP
DPRRAAALAEAVARS
DOMAINcd269/455TSSRPAEGKTTTIANLAVALAEGGQRTVVIDSDLRRPNLANVMGVEGSVGLSDLLIGRAE
LEDVLQPWGTSGLQLLPAGTIPPNPSELLGSPAFAALIESVSEEFDYVLVDTPPLGSVSD
AALVSASVQNMLLVVASGRVRRADVSASIESLRTVGAAVQGAVVTMTRSRAGKDRYAEYA
YSAQPVA
SITEWalker A276/278GKT
SITEWalker A'296/303VVIDSDLR
SITEWalker B376/382VLVDTPP
SITEY Cluster444/449YAEYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPLFRALLSRWYIVVAGILLGCVAAMALSATVTPQYRATTKLWVSVGGDAETSALELAQGSNAAQQRIRSYLDLVSQPI
MTPLFRALLSRWYIVVAGILLGCVAAMALSATVTPQYRATTKLWVSVGGDAETSALELAQGSNAAQQRIRSYLDLVSQPI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIEELGLSTSAGALAGAVSATSPTGSVVMEISVTSPDPRRAAALAEAVARSFTQVVEQRLDANADAAGTGVGVTET
VLDPVIEELGLSTSAGALAGAVSATSPTGSVVMEISVTSPDPRRAAALAEAVARS                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPPTVPTTPVEPRTTANVTLGALIGGAVGALAAFLWWSLDTKVRGREEVQSLWDLAVLGEIGFDQEATKRPLILRDERAS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRAEAFRSLRTNVQFLSSRPQGARTVAITSSRPAEGKTTTIANLAVALAEGGQRTVVIDSDLRRPNLANVMGVEGSVGLS
                            TSSRPAEGKTTTIANLAVALAEGGQRTVVIDSDLRRPNLANVMGVEGSVGLS
                                   GKT                 VVIDSDLR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLIGRAELEDVLQPWGTSGLQLLPAGTIPPNPSELLGSPAFAALIESVSEEFDYVLVDTPPLGSVSDAALVSASVQNML
DLLIGRAELEDVLQPWGTSGLQLLPAGTIPPNPSELLGSPAFAALIESVSEEFDYVLVDTPPLGSVSDAALVSASVQNML
                                                       VLVDTPP                  
       410       420       430       440       450       460         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LVVASGRVRRADVSASIESLRTVGAAVQGAVVTMTRSRAGKDRYAEYAYSAQPVARSVGARMPKRRRAA
LVVASGRVRRADVSASIESLRTVGAAVQGAVVTMTRSRAGKDRYAEYAYSAQPVA              
                                           YAEYAY                    
© 1998-2019