BYKdb

Annotate results for A0A147E2K4

A0A147E2K4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147E2K4
DOMAINtad1/135MSLRVIAGSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQ
GSVYTQSQMLSFAQLATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITD
DPKAAAELADAVADQ
DOMAINcd267/445TSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSVLLDEVE
FEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVAD
ANLFATQTDGVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
SITEWalker A274/276GKS
SITEWalker A'294/301LLIDADMR
SITEWalker B374/380VVIDSPP
SITE-371/-373YDY
SITEY Cluster442/443YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLRVIAGSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQLATSSR
MSLRVIAGSLRKFWWAIVLCAVVGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQLATSSR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTITAQVID
VLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQ                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLIGVLDTRMRNEETLTEAGGDPVLGVVSKSPLLAMRGIAVAQEPLGH


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSV
                          TSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSV
                                 GKS                 LLIDADMR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTDGVILV
LLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMNQLLDFAAAEYDYVVIDSPPILSVADANLFATQTDGVILV
                                                     VVIDSPP                    
       410       420       430       440     
....:....|....:....|....:....|....:....|....:
VDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
VDATKTRRAALAKSIKSLESGGARILGTVLNRARPDRHRSEYYSD
                                         YY  
© 1998-2019