BYKdb

Annotate results for A0A147F0T8

A0A147F0T8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147F0T8
DOMAINtad1/136MELRDYLRILHRNWILILAMTILGGAGAFGYSLLQTPTYEASSQLYVSVRSDSSGISELA
QGTTFARQAVVSFVDVVDSAVVLDRVIDDLNLDTTAQKLAGSISASSPQNSVIITIRATA
ADADMAAAIANSVGTN
DOMAINcd269/456SSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGVEGGVGLTDVLIGRAE
LVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLAALSDAFDYVLVDAPPLLLVTD
AAVISRFTSGVLMVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAY
SYSAPEEA
SITEWalker A276/278GKS
SITEWalker A'296/303VLVDGDLR
SITEWalker B376/382VLVDAPP
SITEY Cluster443/450YGYGAYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELRDYLRILHRNWILILAMTILGGAGAFGYSLLQTPTYEASSQLYVSVRSDSSGISELAQGTTFARQAVVSFVDVVDSA
MELRDYLRILHRNWILILAMTILGGAGAFGYSLLQTPTYEASSQLYVSVRSDSSGISELAQGTTFARQAVVSFVDVVDSA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLDRVIDDLNLDTTAQKLAGSISASSPQNSVIITIRATAADADMAAAIANSVGTNFADVVVNRLEKPEGEAASLVRVET
VVLDRVIDDLNLDTTAQKLAGSISASSPQNSVIITIRATAADADMAAAIANSVGTN                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAPALVPTSPSSPHTPLNVALGLIVGLAAGLGIAVLRSVLDTRIHSLHDIEAATEAPVLGGIALDPDAKKRPLIVHADPR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPRAESFRSLRTNLQFVDVDGSSRSFVVSSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGVEGGVGLT
                            SSAGPGEGKSTTTANLAIALAETGARVVLVDGDLRLPRVADYMGVEGGVGLT
                                   GKS                 VLVDGDLR                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLAALSDAFDYVLVDAPPLLLVTDAAVISRFTSGVL
DVLIGRAELVDVLQQWGTGKLFVLPSGRTPPNPSELLGSQAMQRTLAALSDAFDYVLVDAPPLLLVTDAAVISRFTSGVL
                                                       VLVDAPP                  
       410       420       430       440       450       460       470     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
MVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPEEATSPREGGERRSRRDRADEK
MVAASGTTKKPQLTAAVEKLQAIGSRLFGVIVTMLPSKGPDSYGYGAYSYSAPEEA                   
                                          YGYGAYSY                         
© 1998-2019