BYKdb

Annotate results for A0A147H8S3

A0A147H8S3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147H8S3
DOMAINtad15/271SDINFSALFGMLIDYKWQLLSVIGIFAALGIGYAVLATPMYSSNAMIQIEMEKKGVTRLT
DQTSGMPPPMPEAVTEIELLKSRSVIGKAIENLKLDIVVKPRYFPIFGNFVARRFQPQND
TDVASPLLGLNSFAWGGEKLVIDQLEVPDSNLDKPMKLKVEDNQNFTVFNNDDEVVLHGS
LGQPVSNAGYQIQVSTLQARPGTEFTIMKQRFSKTIQEYQGRLVAGERGKMSGIIGIGIQ
DSDPLRAQAIVQEVADI
DOMAINcd549/736SGPSPGVGKSFVSSNLAAVIAESGQRVLLIDGDMRKGYLHKLMNTKQQDGLSDLLSGRIA
LNDAIKKTEVGSLDFVSCGQFPPNPSELLMSLRFTTVLKKFSELYDIVIIDTPPILAVTE
AGIIGSHAGTSLIVARFGVNSVKELEATKRRFDLNGIPLKGVIFNAVERKASNYGSYGNY
HYSYEQGS
SITEWalker A556/558GKS
SITEWalker A'576/583LLIDGDMR
SITEWalker B656/662VIIDTPP
SITEY Cluster722/732YGSYGNYHYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTTMPRFTPELKNESDINFSALFGMLIDYKWQLLSVIGIFAALGIGYAVLATPMYSSNAMIQIEMEKKGVTRLTDQTSGM
              SDINFSALFGMLIDYKWQLLSVIGIFAALGIGYAVLATPMYSSNAMIQIEMEKKGVTRLTDQTSGM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPPMPEAVTEIELLKSRSVIGKAIENLKLDIVVKPRYFPIFGNFVARRFQPQNDTDVASPLLGLNSFAWGGEKLVIDQLE
PPPMPEAVTEIELLKSRSVIGKAIENLKLDIVVKPRYFPIFGNFVARRFQPQNDTDVASPLLGLNSFAWGGEKLVIDQLE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPDSNLDKPMKLKVEDNQNFTVFNNDDEVVLHGSLGQPVSNAGYQIQVSTLQARPGTEFTIMKQRFSKTIQEYQGRLVAG
VPDSNLDKPMKLKVEDNQNFTVFNNDDEVVLHGSLGQPVSNAGYQIQVSTLQARPGTEFTIMKQRFSKTIQEYQGRLVAG

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERGKMSGIIGIGIQDSDPLRAQAIVQEVADIYVQQNIDRNAAESTQSLEFLRAQIPVVKSDLEKAQSALNYYQTNKKSVD
ERGKMSGIIGIGIQDSDPLRAQAIVQEVADI                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDSETKGVLEQSVALDNQISELNLKRTEMDRKFTRQHPAYQALMSQLGQLQAERAKLQKRVEVLPETQQELLRLNRDIEV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSQTYALMLNKAQELEVIRAGTVGSVRIIDNANANVDDPSAPNKPLIIAVAIILGGIVGLAIVYTRHTLRRGVETPEAIE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIGLPVYASIPFSKNQADAAKGLGAKKPGESSLTALTHPTDLSTEALRSLRTSLHFAMIEAKNNILMISGPSPGVGKSFV
                                                                    SGPSPGVGKSFV
                                                                           GKS  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSNLAAVIAESGQRVLLIDGDMRKGYLHKLMNTKQQDGLSDLLSGRIALNDAIKKTEVGSLDFVSCGQFPPNPSELLMSL
SSNLAAVIAESGQRVLLIDGDMRKGYLHKLMNTKQQDGLSDLLSGRIALNDAIKKTEVGSLDFVSCGQFPPNPSELLMSL
               LLIDGDMR                                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFTTVLKKFSELYDIVIIDTPPILAVTEAGIIGSHAGTSLIVARFGVNSVKELEATKRRFDLNGIPLKGVIFNAVERKAS
RFTTVLKKFSELYDIVIIDTPPILAVTEAGIIGSHAGTSLIVARFGVNSVKELEATKRRFDLNGIPLKGVIFNAVERKAS
               VIIDTPP                                                          
       730        
....:....|....:...
NYGSYGNYHYSYEQGSKS
NYGSYGNYHYSYEQGS  
 YGSYGNYHYSY      

© 1998-2019