BYKdb

Annotate results for A0A147HWG8

A0A147HWG8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147HWG8
DOMAINtad15/189TPSILRQYMRMVQRRRWVIISIVAVCVLLALVMTLLTTPKYTATTTVEIARESARVTDFQ
GVERESSAFDQEFYQTQYGLLKSRGLAERVATQLRLVDDPAFFDRVGIKRDQGAFQKING
KYVASGRAERQRVAGVALLNSIAVNPTRLSRLVNIVYTSTDPKFAAVVANAWAEN
DOMAINcd530/716TSTRPAEGKSTTALALATTLARSERRVILVDGDMRSPSVHDLGGFSNQRGLSNYLTGDDN
ISTLVLPMDDLGISAMVAGPLPPNAAELLTGTRLSKLIEQLLENYDHVVIDSPPVMGLAD
APLIGARVEGVVYAIESHGIRATLVKTALARLSNSNVRIFGGVLTKLEAKKTQYGYEYGY
GYGRDDA
SITEWalker A537/539GKS
SITEWalker A'557/564ILVDGDMR
SITEWalker B637/643VVIDSPP
SITEY Cluster703/711YGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAELHPINPGMESDTPSILRQYMRMVQRRRWVIISIVAVCVLLALVMTLLTTPKYTATTTVEIARESARVTDFQGVERES
              TPSILRQYMRMVQRRRWVIISIVAVCVLLALVMTLLTTPKYTATTTVEIARESARVTDFQGVERES

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAFDQEFYQTQYGLLKSRGLAERVATQLRLVDDPAFFDRVGIKRDQGAFQKINGKYVASGRAERQRVAGVALLNSIAVNP
SAFDQEFYQTQYGLLKSRGLAERVATQLRLVDDPAFFDRVGIKRDQGAFQKINGKYVASGRAERQRVAGVALLNSIAVNP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRLSRLVNIVYTSTDPKFAAVVANAWAENFIQTNLERKVQATSYGRNLLERQLAQTKQRLDEAQRQLVAYASSAQIINLP
TRLSRLVNIVYTSTDPKFAAVVANAWAEN                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQPGPNGTTSERSIVADDLAALNSSLAQAVADRIQAEARMREAGSAGTSTEALRNQAINGLRQRRAELAAEYQRLMVQFE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGYPAALAIKSQLDQLDRSIAREEGRVAGSVQADYREALAREQSLQQRVEQLKTKFLENRRRSIQYNIYQQEVDTSRTLY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGLLQRYKEIGVAGGVGVNNIAIVDLAEVPQRPSSPRLTINLAVGLLSGLLLGAAAAFALEQIDESLAEPEEIRRRLGVP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGSVPKLAMGSPREALLDRKSALVDAYIAIQTSLAFTTEQGVPRSFSVTSTRPAEGKSTTALALATTLARSERRVILVD
                                                 TSTRPAEGKSTTALALATTLARSERRVILVD
                                                        GKS                 ILVD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMRSPSVHDLGGFSNQRGLSNYLTGDDNISTLVLPMDDLGISAMVAGPLPPNAAELLTGTRLSKLIEQLLENYDHVVID
GDMRSPSVHDLGGFSNQRGLSNYLTGDDNISTLVLPMDDLGISAMVAGPLPPNAAELLTGTRLSKLIEQLLENYDHVVID
GDMR                                                                        VVID
       650       660       670       680       690       700       710      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
SPPVMGLADAPLIGARVEGVVYAIESHGIRATLVKTALARLSNSNVRIFGGVLTKLEAKKTQYGYEYGYGYGRDDA
SPPVMGLADAPLIGARVEGVVYAIESHGIRATLVKTALARLSNSNVRIFGGVLTKLEAKKTQYGYEYGYGYGRDDA
SPP                                                           YGYEYGYGY     

© 1998-2019