BYKdb

Annotate results for A0A147IPU1

A0A147IPU1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147IPU1
DOMAINtad20/184LSSMYRQVLEILRLRWRTLAATFVTIAVLGTAYTMMLTPRYQATARVKIDPSKSAALGQI
TDAASSIPDQSVVETEVSVMRSHDIAAAVVAREHLLNDPEFTKGMPPLGARATPAQIADR
TEAVAQAVLGRMSASREKATYIVEVGFTSTNPEKAARIANAFAET
DOMAINcd524/712TSTLPNEGKTTSALSLARIMAMAGEKTLLIDTDLRRAGLREATGISPERGLVELLHGDIT
LAEAVVADQVEGLDLLPVAQANYSPEDLFSGDAMADLLTQVRGAYDRIVLDCAPLLGVAD
ARTVAMLSDAVLMVIKWNATPRNAIATGLNWLARDKAPVTGALLTMVDRSVEAYGALYYS
KKYAEYYRA
SITEWalker A531/533GKT
SITEWalker A'551/558LLIDTDLR
SITEWalker B631/637IVLDCAP
SITEY Cluster697/710YGALYYSKKYAEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDVTAHTGLPSPTGGEPETLSSMYRQVLEILRLRWRTLAATFVTIAVLGTAYTMMLTPRYQATARVKIDPSKSAALGQIT
                   LSSMYRQVLEILRLRWRTLAATFVTIAVLGTAYTMMLTPRYQATARVKIDPSKSAALGQIT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAASSIPDQSVVETEVSVMRSHDIAAAVVAREHLLNDPEFTKGMPPLGARATPAQIADRTEAVAQAVLGRMSASREKATY
DAASSIPDQSVVETEVSVMRSHDIAAAVVAREHLLNDPEFTKGMPPLGARATPAQIADRTEAVAQAVLGRMSASREKATY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVEVGFTSTNPEKAARIANAFAETYIDASLTRRNGTASRQAEFLQKRLSSLSAQATAADERLASYRAASGVVQTGGGSTS
IVEVGFTSTNPEKAARIANAFAET                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDQQIAPLAGQLATAQSDAAAAASKVAAARAQIRTGGIDAVSAVLDSEVIKNLRSQRAQLLSEQGEVSTRYGPKHPETQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIAQQIRTIDQQILDEANRVIGGLESEARAASARAASLQANLNVLRGRQAQTTRASAMAETYERQADSSKQAYDRLAQQA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTSDQAASSSLSQAQVIENATPPSSPSKPNKRMLLAATFVGALLAGLGVVCLQELTSRGLRSIADVRRLGLDVLATVPRL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRGHAAPADEVIAKPMSSFAEAYRVTRRSLASASSGRPMVVAITSTLPNEGKTTSALSLARIMAMAGEKTLLIDTDLRRA
                                           TSTLPNEGKTTSALSLARIMAMAGEKTLLIDTDLRRA
                                                  GKT                 LLIDTDLR  
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLREATGISPERGLVELLHGDITLAEAVVADQVEGLDLLPVAQANYSPEDLFSGDAMADLLTQVRGAYDRIVLDCAPLLG
GLREATGISPERGLVELLHGDITLAEAVVADQVEGLDLLPVAQANYSPEDLFSGDAMADLLTQVRGAYDRIVLDCAPLLG
                                                                      IVLDCAP   
       650       660       670       680       690       700       710   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VADARTVAMLSDAVLMVIKWNATPRNAIATGLNWLARDKAPVTGALLTMVDRSVEAYGALYYSKKYAEYYRAE
VADARTVAMLSDAVLMVIKWNATPRNAIATGLNWLARDKAPVTGALLTMVDRSVEAYGALYYSKKYAEYYRA 
                                                        YGALYYSKKYAEYY   

© 1998-2019