BYKdb

Annotate results for A0A147IUL2

A0A147IUL2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147IUL2
DOMAINtad9/166LGDVAADLGSALRRRIWLLLGIAIPLFVVAVIVISMLQPRYDATTRIRIDPSRNPMAQDQ
AQSMVNSEAIETEIGVMTSLELARTVVKTLHLDQDPTFTRGLPPAGQMSETERLNIVARR
VMQNLAVGRDKLSYLIAMSYRARDPNKAADIANAFADD
DOMAINcd513/702TSALPDEGKTTLALSFARMAAINSMRTLLIDCDLRNAGLRKITSSSIPENDVIQVLEGTC
PLSQAVAPDQVPGLDLLGVSQPLFTSQDLFAHGAMERLLAEAKKSYDQIILDLPPVLGVA
DARTIATIADTTPLVVRWGKTPPKAVKLALTALEGDGAVVPGIVLSMVDPMSDAVGGFYY
SSRYAKYYQS
SITE-651/-653GKT
SITEWalker A'540/547LLIDCDLR
SITEWalker B621/627IILDLPP
SITEY Cluster691/700YYSSRYAKYY
SITEWalker A520/522GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSAGHRRRLGDVAADLGSALRRRIWLLLGIAIPLFVVAVIVISMLQPRYDATTRIRIDPSRNPMAQDQAQSMVNSEAIET
        LGDVAADLGSALRRRIWLLLGIAIPLFVVAVIVISMLQPRYDATTRIRIDPSRNPMAQDQAQSMVNSEAIET

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIGVMTSLELARTVVKTLHLDQDPTFTRGLPPAGQMSETERLNIVARRVMQNLAVGRDKLSYLIAMSYRARDPNKAADIA
EIGVMTSLELARTVVKTLHLDQDPTFTRGLPPAGQMSETERLNIVARRVMQNLAVGRDKLSYLIAMSYRARDPNKAADIA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAFADDYIKLRVGSQVGTSERQADFFRDRLSDLGREVRAAESALASYRARNGISSNTTEGTVVDEQIGSLSSQLATAEAT
NAFADD                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAAARSKASIAAAQVARGGLDAVSEVRNSNVISDLRRQRAEIIRNMGEVQARYGDKHPESIRVRDQLKAVDAQITDEAAR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVNSLKADANAADAQVASLRSSMRGLEGDRAKNTRASAEALGLEREAASKRAAYDRMSQLSLDSTQSARGSIAQAEIVDR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARPPSAPTSPNRKLLIVLAAVVAIATGLGVVLVLEMFQGGFRTIAEVEDELNLPVLGSIPIEGSRRRIGKSGRSPADGVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GNRATMYSEAIRNVRASIVGHGQSVSPTVVAFTSALPDEGKTTLALSFARMAAINSMRTLLIDCDLRNAGLRKITSSSIP
                                TSALPDEGKTTLALSFARMAAINSMRTLLIDCDLRNAGLRKITSSSIP
                                       GKT                 LLIDCDLR             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENDVIQVLEGTCPLSQAVAPDQVPGLDLLGVSQPLFTSQDLFAHGAMERLLAEAKKSYDQIILDLPPVLGVADARTIATI
ENDVIQVLEGTCPLSQAVAPDQVPGLDLLGVSQPLFTSQDLFAHGAMERLLAEAKKSYDQIILDLPPVLGVADARTIATI
                                                            IILDLPP             
       650       660       670       680       690       700   
....:....|....:....|....:....|....:....|....:....|....:....|...
ADTTPLVVRWGKTPPKAVKLALTALEGDGAVVPGIVLSMVDPMSDAVGGFYYSSRYAKYYQSN
ADTTPLVVRWGKTPPKAVKLALTALEGDGAVVPGIVLSMVDPMSDAVGGFYYSSRYAKYYQS 
                                                  YYSSRYAKYY   

© 1998-2019