BYKdb

Annotate results for A0A147J8U7

A0A147J8U7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A147J8U7
DOMAINtad29/203AMPIIRQYLRVAMRWRYVIAGTAIACLVLGLVVTLLMTPKYTATSIIEISRDSSQVTNFQ
GVERETSVADQEFYQTQYGLLESRSLSERVASQLRLVDDPKFFALFGVKSEDPAFQQQNG
RYTAQGRNVRLRVAGELLLHHLNIEPTRLSRLVNIRFTSPSAEFSARVANTWADA
DOMAINcd544/733TSTRPAEGKSTTALAIATMLARSKKTVILVDGDMRSPSVHHLGGVDHAYGLSNFLAGQDD
IAGLTFQMSDLGFTAMSAGPIPPNAAELLTGNRLALLVSRLLETYDHVVIDSPPVMGLAD
APLIASRVEGVIYTVESHGIRSSMVKTALGRLASANAHIFGGVLTKFEARKAHYGYGYEY
GYGYGRSAKA
SITEWalker A551/553GKS
SITEWalker A'571/578ILVDGDMR
SITEWalker B651/657VVIDSPP
SITEY Cluster717/727YGYGYEYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHIVPSSAQAAAGLTPLPVAAQSGPEREAMPIIRQYLRVAMRWRYVIAGTAIACLVLGLVVTLLMTPKYTATSIIEISRD
                            AMPIIRQYLRVAMRWRYVIAGTAIACLVLGLVVTLLMTPKYTATSIIEISRD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQVTNFQGVERETSVADQEFYQTQYGLLESRSLSERVASQLRLVDDPKFFALFGVKSEDPAFQQQNGRYTAQGRNVRLR
SSQVTNFQGVERETSVADQEFYQTQYGLLESRSLSERVASQLRLVDDPKFFALFGVKSEDPAFQQQNGRYTAQGRNVRLR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAGELLLHHLNIEPTRLSRLVNIRFTSPSAEFSARVANTWADAFIQTNLERKVQATSYGRNLLQRELGQVKERLDESQRQ
VAGELLLHHLNIEPTRLSRLVNIRFTSPSAEFSARVANTWADA                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVSYASAQGIINLPGQTNANGTTSERSIVADELAGLSTALTQATADRIAAEAQFRQAGRPGVSSEALRNQAINSLRQRRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELAADYERMMVQFEPSYPPARAIKSQLDQLDRSIGREESRVSGSLEANYRQALERERGLNARVEQLKSSFLDLRRRSIQY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIYQQEVDTNRALYDGLLQRFKEIGVAGGVGINNISVVDPADVPQAPSSPRLIINLIVSLLVGTVLGAAIAIGLEQIDEA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IADPVEVERRLGLPLLGSVPKVEGISPKEALLDRKSEMVDAYLAIQTNLAFTTEHGVPRSLAITSTRPAEGKSTTALAIA
                                                               TSTRPAEGKSTTALAIA
                                                                      GKS       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMLARSKKTVILVDGDMRSPSVHHLGGVDHAYGLSNFLAGQDDIAGLTFQMSDLGFTAMSAGPIPPNAAELLTGNRLALL
TMLARSKKTVILVDGDMRSPSVHHLGGVDHAYGLSNFLAGQDDIAGLTFQMSDLGFTAMSAGPIPPNAAELLTGNRLALL
          ILVDGDMR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSRLLETYDHVVIDSPPVMGLADAPLIASRVEGVIYTVESHGIRSSMVKTALGRLASANAHIFGGVLTKFEARKAHYGYG
VSRLLETYDHVVIDSPPVMGLADAPLIASRVEGVIYTVESHGIRSSMVKTALGRLASANAHIFGGVLTKFEARKAHYGYG
          VVIDSPP                                                           YGYG
       730     
....:....|....:
YEYGYGYGRSAKASD
YEYGYGYGRSAKA  
YEYGYGY        

© 1998-2019