BYKdb

Annotate results for A0A147K4J4

A0A147K4J4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A147K4J4
DOMAINcd63/243TSSFPGEGKSTTSANLGVVFAQQGKKVLFVDADLRKPTVHYTFNVNNLFGLTTVLTKQKS
LIETVQGTKIEGLDVLPCGPIPPNPAELLGSRGMEEFLREAYETYDLVIFDTPPVLAVTD
AQILANQCDGTILVVSAGTTEIEGAQKAKELLTSAKAKLLGVVLNNKSNKSTNYYYYYGT
K
SITEWalker A70/72GKS
SITEWalker A'90/97LFVDADLR
SITEWalker B170/176VIFDTPP
SITE-164/-167YETY
SITEY Cluster236/240YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MREIDDTEVTKLARKKKTTMMDSRRKLISQISPKSPITEQYRTIRTNIQFSAVDQEVRSLLVTSSFPGEGKSTTSANLGV
                                                              TSSFPGEGKSTTSANLGV
                                                                     GKS        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFAQQGKKVLFVDADLRKPTVHYTFNVNNLFGLTTVLTKQKSLIETVQGTKIEGLDVLPCGPIPPNPAELLGSRGMEEFL
VFAQQGKKVLFVDADLRKPTVHYTFNVNNLFGLTTVLTKQKSLIETVQGTKIEGLDVLPCGPIPPNPAELLGSRGMEEFL
         LFVDADLR                                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REAYETYDLVIFDTPPVLAVTDAQILANQCDGTILVVSAGTTEIEGAQKAKELLTSAKAKLLGVVLNNKSNKSTNYYYYY
REAYETYDLVIFDTPPVLAVTDAQILANQCDGTILVVSAGTTEIEGAQKAKELLTSAKAKLLGVVLNNKSNKSTNYYYYY
         VIFDTPP                                                           YYYYY
   
...
GTK
GTK

© 1998-2019