BYKdb

Annotate results for A0A149PDM3

A0A149PDM3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A149PDM3
DOMAINtad1/248MLTLMRDHIWEIVVTTVVVLTLAVAYLLIATPIYSADVIVRVDPPEPNALGLALQNQDLM
PPPAPSPVTEMAVMESRAVLQPVIDQFRFDISVKPHKLPVLGDIAEKFATPGQPAAPWLG
LKSFAWGGERVQIASLDVPRELEEEKLTLTALENGAYELHGPSGELLASGVVGVPLKQNG
VSMLVKELAARPGTKFEVIRWNELDAIKRFESLVKIGDKVKDSGLLQIQYRDKSPDKAAA
VANALGQQ
DOMAINcd552/739IGPTPSAGKSFVAANLASLHAEIGARVVLIDADMRRGHLASLFSESNRGGLSEVLAERLP
LRNALRATGIDGLTFLSCGVRPENPAALLMKPRLKDVLERLSSQFDLVIIDTPPFLAVTD
ASIIANEAGASLLVLRSGMQSEEEIADTLRKVERAEGRIAGAVFNGIPLRRSTKNYGYET
NYASDFGE
SITEWalker A559/561GKS
SITEWalker A'579/586VLIDADMR
SITEWalker B659/665VIIDTPP
SITEY Cluster727/733YGYETNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTLMRDHIWEIVVTTVVVLTLAVAYLLIATPIYSADVIVRVDPPEPNALGLALQNQDLMPPPAPSPVTEMAVMESRAVL
MLTLMRDHIWEIVVTTVVVLTLAVAYLLIATPIYSADVIVRVDPPEPNALGLALQNQDLMPPPAPSPVTEMAVMESRAVL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPVIDQFRFDISVKPHKLPVLGDIAEKFATPGQPAAPWLGLKSFAWGGERVQIASLDVPRELEEEKLTLTALENGAYELH
QPVIDQFRFDISVKPHKLPVLGDIAEKFATPGQPAAPWLGLKSFAWGGERVQIASLDVPRELEEEKLTLTALENGAYELH

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPSGELLASGVVGVPLKQNGVSMLVKELAARPGTKFEVIRWNELDAIKRFESLVKIGDKVKDSGLLQIQYRDKSPDKAAA
GPSGELLASGVVGVPLKQNGVSMLVKELAARPGTKFEVIRWNELDAIKRFESLVKIGDKVKDSGLLQIQYRDKSPDKAAA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VANALGQQYLASAVASRQSNDTQTLAFINGELPRLLGDLRKAEEALKNFRSTSQSMQPTSEAQAYLQGGLDLDKQIAALQ
VANALGQQ                                                                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQRTQLLERYTEQSRWVQNVDEQLTQLKQAKAQFSGHFNGMPASERESVDLIRAQKVAETIYLGMVQKAEQLQVRRASTT


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGAHILDQAIRPHMPVMPQPILVLGGGLVLGIVSGVVLVFMRRHVMIGVTDPRYVERQMSVPVFGEILFSHQQVQLDRDS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSAGRKSLPGVAGRAHPPMQKSLHDFQFEHGDQNRILAARFPHDTSVEALRSVRTAVTRDLAHARNNIVMIIGPTPSAGK
                                                                       IGPTPSAGK
                                                                              GK
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFVAANLASLHAEIGARVVLIDADMRRGHLASLFSESNRGGLSEVLAERLPLRNALRATGIDGLTFLSCGVRPENPAALL
SFVAANLASLHAEIGARVVLIDADMRRGHLASLFSESNRGGLSEVLAERLPLRNALRATGIDGLTFLSCGVRPENPAALL
S                 VLIDADMR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKPRLKDVLERLSSQFDLVIIDTPPFLAVTDASIIANEAGASLLVLRSGMQSEEEIADTLRKVERAEGRIAGAVFNGIPL
MKPRLKDVLERLSSQFDLVIIDTPPFLAVTDASIIANEAGASLLVLRSGMQSEEEIADTLRKVERAEGRIAGAVFNGIPL
                  VIIDTPP                                                       
       730       740       750
....:....|....:....|....:....|
RRSTKNYGYETNYASDFGEPDGAGQAPRGA
RRSTKNYGYETNYASDFGE           
      YGYETNY                 

© 1998-2019