BYKdb

Annotate results for A0A149Q0U5

A0A149Q0U5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A149Q0U5
DOMAINtad18/270PPAGFANYLDALYDNRKLISITTAIAVALGIGYSVFSQPVYRADILVQVEENAGTSSKSV
IGDVSAMFDVKTATSGEAQVIGSRMVVGPAVDKLNLDIQATPRYYPIFGSWLARHSDSLS
TPGPHGYVYGSERIEVSKFDLPEELFDRPFVLRMGEGSNYELQYGKLKLDGTVGQPLNAT
TNYGPLTLLVDRIEAKPGATFELRREAALSTTEKLRKDLTISEKGKESDILGVSLEGSDP
KKISSILATIAGE
DOMAINcd547/738TGPTPGIGKSFVSLNLAAVIGATGKRVLLVDGDLRRGFLHRHLGGERGPGLSDLIQGSYR
PEELIRPTRFQGVDFIASGRQVASPSDVLSNTRLDSILRQVATGYDVVLLDGPPVLLASD
AVRLACVAGTTFFVARQGTTGIGELRESVRQMQKVGLPVRGVIMNGLKMRPGRYSYGYGR
YRYAAYIYKPYD
SITEWalker A554/556GKS
SITEWalker A'574/581LLVDGDLR
SITEWalker B654/660VLLDGPP
SITEY Cluster720/737YSYGYGRYRYAAYIYKPY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQSSAPFDSRNNNSEHPPAGFANYLDALYDNRKLISITTAIAVALGIGYSVFSQPVYRADILVQVEENAGTSSKSVIGD
                 PPAGFANYLDALYDNRKLISITTAIAVALGIGYSVFSQPVYRADILVQVEENAGTSSKSVIGD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSAMFDVKTATSGEAQVIGSRMVVGPAVDKLNLDIQATPRYYPIFGSWLARHSDSLSTPGPHGYVYGSERIEVSKFDLPE
VSAMFDVKTATSGEAQVIGSRMVVGPAVDKLNLDIQATPRYYPIFGSWLARHSDSLSTPGPHGYVYGSERIEVSKFDLPE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELFDRPFVLRMGEGSNYELQYGKLKLDGTVGQPLNATTNYGPLTLLVDRIEAKPGATFELRREAALSTTEKLRKDLTISE
ELFDRPFVLRMGEGSNYELQYGKLKLDGTVGQPLNATTNYGPLTLLVDRIEAKPGATFELRREAALSTTEKLRKDLTISE

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGKESDILGVSLEGSDPKKISSILATIAGEYVSQNVKRKSEEAERSIRFLELQLPELHQQLSTSETRFNDFRAKHGTVDL
KGKESDILGVSLEGSDPKKISSILATIAGE                                                  

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEEATNLLQLSVQAQTRLAELEQKRNELLSRFTDQHPAVQSVNAQLNAARQEARDLANRTQALPPLEQNVLRLQRDVQVG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELDTSLRNTLEQLKLIKAGKAGNVRILDAAVAPDKPVRPKPLLIITAAMMLGVFVGVVISLVRQRLFDAIDDPYEVELR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGLPVYASVPFSRQEERFAQSRRRSDAKALVLAGEAVIDPAIESLRGFRTALEFTMTKARNHIVLITGPTPGIGKSFVSL
                                                                  TGPTPGIGKSFVSL
                                                                         GKS    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAAVIGATGKRVLLVDGDLRRGFLHRHLGGERGPGLSDLIQGSYRPEELIRPTRFQGVDFIASGRQVASPSDVLSNTRL
NLAAVIGATGKRVLLVDGDLRRGFLHRHLGGERGPGLSDLIQGSYRPEELIRPTRFQGVDFIASGRQVASPSDVLSNTRL
             LLVDGDLR                                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSILRQVATGYDVVLLDGPPVLLASDAVRLACVAGTTFFVARQGTTGIGELRESVRQMQKVGLPVRGVIMNGLKMRPGRY
DSILRQVATGYDVVLLDGPPVLLASDAVRLACVAGTTFFVARQGTTGIGELRESVRQMQKVGLPVRGVIMNGLKMRPGRY
             VLLDGPP                                                           Y
       730         
....:....|....:....
SYGYGRYRYAAYIYKPYDR
SYGYGRYRYAAYIYKPYD 
SYGYGRYRYAAYIYKPY  

© 1998-2019