BYKdb

Annotate results for A0A150B1P3

A0A150B1P3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150B1P3
DOMAINcd54/233TSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSER
LEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDLVIFDMPPILAVTD
AQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
SITEWalker A61/63GKT
SITEWalker A'81/88LLIDADMR
SITEWalker B161/167VIFDMPP
SITE-155/-158YSMY
SITEY Cluster227/230YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALNLFKKKKNHRQRRQLIAHQQPKSPISEQYRNIRTNIEFAAVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKKV
                                                     TSANPSEGKTTTTANMAVVFAQQGKKV
                                                            GKT                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
LLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTSVDNLHFLACGPIPPNPAELLGSKSMQELLAQAYSMYDL
LLIDADMR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
VIFDMPPILAVTDAQIMANQCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGAN
VIFDMPP                                                           YYYY   
© 1998-2019