BYKdb

Annotate results for A0A150CGM3

A0A150CGM3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150CGM3
DOMAINcd55/234TSANPSEGKTTTTANMAVVFAQQGKKVLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSER
LEKCVQTTNVDNLYFLACGPIPPNPAELLGSKSMKELLGQAYSMYDLVIFDLPPILAVTD
AQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
SITEWalker A62/64GKT
SITEWalker A'82/89LLIDADMR
SITEWalker B162/168VIFDLPP
SITE-156/-159YSMY
SITEY Cluster228/231YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALNSLFKKKQNHRQRRQLIAHQQPQSPISEQYRNIRTNIEFASVDTNLHSLMVTSANPSEGKTTTTANMAVVFAQQGKK
                                                      TSANPSEGKTTTTANMAVVFAQQGKK
                                                             GKT                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTNVDNLYFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
VLLIDADMRKPAMHQMFQVDNIFGLTNVLTHSERLEKCVQTTNVDNLYFLACGPIPPNPAELLGSKSMKELLGQAYSMYD
 LLIDADMR                                                                       
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
LVIFDLPPILAVTDAQIMANVCDASILVVRSESTEKETAVKAKGLLESAKGKLLGVVLNDREREQGLYYYYGTN
 VIFDLPP                                                           YYYY   
© 1998-2019