BYKdb

Annotate results for A0A150FSI8

A0A150FSI8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150FSI8
DOMAINcd40/226TSAGQSEGKSTTIANIAASLAELGKKIILLDCDFRRPSVHKKFNITNNKGITDILLNNYD
YKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEYILIDAPPVGIVSDA
AILSTFIDGVILLASCGETQIEHIKKAKETLENVGAKILGVVLNKLEVEKNRAYGYYAYY
YQDEENT
SITEWalker A47/49GKS
SITEWalker A'67/74ILLDCDFR
SITEWalker B146/152ILIDAPP
SITE-98/-145YDYKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEY
SITEY Cluster213/220YGYYAYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQNIIVFKDPKSPISEAYRNIRTNILFSNIDENLQTILITSAGQSEGKSTTIANIAASLAELGKKIILLDCDFRRPSVHK
                                       TSAGQSEGKSTTIANIAASLAELGKKIILLDCDFRRPSVHK
                                              GKS                 ILLDCDFR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFNITNNKGITDILLNNYDYKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEYILIDAPPVGIVSDAA
KFNITNNKGITDILLNNYDYKDCIQRIVEGFDIITCGQIPPNPSEIISSNKLKRLVEDLKKDYEYILIDAPPVGIVSDAA
                                                                 ILIDAPP        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILSTFIDGVILLASCGETQIEHIKKAKETLENVGAKILGVVLNKLEVEKNRAYGYYAYYYQDEENTKGKGAKNTKGKRAK
ILSTFIDGVILLASCGETQIEHIKKAKETLENVGAKILGVVLNKLEVEKNRAYGYYAYYYQDEENT              
                                                    YGYYAYYY                    
   
...
KKK


© 1998-2019