BYKdb

Annotate results for A0A150KCA4

A0A150KCA4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150KCA4
DOMAINcd51/231TSSGPGEGKSTITGNLAVVFAQQGKRVLLVDADLRRPTVHYTFGMTNTFGLTTVLTKQGT
LLETVAKCDVENLHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILLDTPPVLAVTD
AQVLTNQCDGTILVVSSGKAEVDAVKKAKELLVSANANLLGVVLNNKKTQNTHYYYYYGK
D
SITEWalker A58/60GKS
SITEWalker A'78/85LLVDADLR
SITEWalker B158/164ILLDTPP
SITEY Cluster224/228YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAPKKTKLLNTRRKLISKLNPTSPISEQFRTIRTNISFSSVDNDLQLLMVTSSGPGEGKSTITGNLAVVFAQQGKRVLLV
                                                  TSSGPGEGKSTITGNLAVVFAQQGKRVLLV
                                                         GKS                 LLV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADLRRPTVHYTFGMTNTFGLTTVLTKQGTLLETVAKCDVENLHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILL
DADLRRPTVHYTFGMTNTFGLTTVLTKQGTLLETVAKCDVENLHVLTSGPIPPNPAELLSSKAMKEFFKEAKEQYDIILL
DADLR                                                                        ILL
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKAKELLVSANANLLGVVLNNKKTQNTHYYYYYGKD
DTPPVLAVTDAQVLTNQCDGTILVVSSGKAEVDAVKKAKELLVSANANLLGVVLNNKKTQNTHYYYYYGKD
DTPP                                                           YYYYY   
© 1998-2019