BYKdb

Annotate results for A0A150MZI7

A0A150MZI7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150MZI7
DOMAINcd52/232TSAGPGEGKSTTTANLAIVFAQQGKKVLLIDADLRKPTVHYTFRLNNYTGLTNVLTNSAP
LLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCMQQLYNEFDLLIFDTPPVLAVTD
SQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRY
K
SITEWalker A59/61GKS
SITEWalker A'79/86LLIDADLR
SITEWalker B159/165LIFDTPP
SITEY Cluster225/231YYYYYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARRDRKKIQKIERSLITMEDPKSPISEQYRTIRTNVQFSFVDKTMRSLMVTSAGPGEGKSTTTANLAIVFAQQGKKVLL
                                                   TSAGPGEGKSTTTANLAIVFAQQGKKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCMQQLYNEFDLLI
IDADLRKPTVHYTFRLNNYTGLTNVLTNSAPLLPSCQETSVENLYVLTSGPIPPNPAELLSSKTMEQCMQQLYNEFDLLI
IDADLR                                                                        LI
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
FDTPPVLAVTDSQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
FDTPPVLAVTDSQILANQCDGTILVIESGGTEIEAAVKAKELLEAANAKLLGVVLNKRKHREGGYYYYYRYK
FDTPP                                                           YYYYYRY 
© 1998-2019