BYKdb

Annotate results for A0A150QDW6

A0A150QDW6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A150QDW6
DOMAINtad21/189RAIDLVATWRTVSKHWAIALTTMLFVALSVTFYTLGQKKIYQSTATLQFDPNPPRPLGRG
VETVVDMGAGSYWNNREYYETQYKVMRSIRVALAVVAQLNLHNDAYFLKDLPRDAAAPAP
MSVSPEEAAEELRERLAVEPVKDSRLAIIRFNDADRERAQRILSMLMDV
DOMAINcd553/742ASAGPAEGKTTVGCCIAVAMAQAGQRVVLMDCDLRRPRLHAIFDKGPEIGVTSALLDDSV
IDDENALKTEVDNLYVIPAGPIPPNPAELLHSDRFKALLRKLQGRFDRVIIDSPPIGAVT
DGAVLSTLVDGTVLVVRASATTHDFARHGIRALLDVGGQTVGVVLNAADLNRREYGAYHY
YGDKREGYYR
SITEWalker A560/562GKT
SITEWalker A'580/587VLMDCDLR
SITEWalker B661/667VIIDSPP
SITEY Cluster727/741YGAYHYYGDKREGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADELRAPPTTAARSDAPGERAIDLVATWRTVSKHWAIALTTMLFVALSVTFYTLGQKKIYQSTATLQFDPNPPRPLGRG
                    RAIDLVATWRTVSKHWAIALTTMLFVALSVTFYTLGQKKIYQSTATLQFDPNPPRPLGRG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VETVVDMGAGSYWNNREYYETQYKVMRSIRVALAVVAQLNLHNDAYFLKDLPRDAAAPAPMSVSPEEAAEELRERLAVEP
VETVVDMGAGSYWNNREYYETQYKVMRSIRVALAVVAQLNLHNDAYFLKDLPRDAAAPAPMSVSPEEAAEELRERLAVEP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKDSRLAIIRFNDADRERAQRILSMLMDVYIEQNLDDALTSTNSAVDWLRTQLDKLKTDLESSETSLHEYKKSNNILDID
VKDSRLAIIRFNDADRERAQRILSMLMDV                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FEDKTNLLREEMKQINDALTAVRTKREEFAARSHELAKVDPNNPLDLPASELIQSPVLQTLRARHEECVRERDALIGSGK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GENHPDVRAAIERVAANRNSLIAEIKNVQGAVNRDLAIVRRQETGLAGLLEGAKKQAFELNSLKIEYDRLRRTKENTEKL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQIVLERTKESDLQRMMRVNNIRVLDRPNLPLEAIRPRVALNIAIGILAGLLLGIGAALARAMLDRTMRTPDEVERELGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PFLGLLPEFDRKDRAEALSGKARRRGKLAVPPSRPELIVHEQPKSGIAEAARAIRTNLLFMSPDQPYKTLLIASAGPAEG
                                                                        ASAGPAEG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTTVGCCIAVAMAQAGQRVVLMDCDLRRPRLHAIFDKGPEIGVTSALLDDSVIDDENALKTEVDNLYVIPAGPIPPNPAE
KTTVGCCIAVAMAQAGQRVVLMDCDLRRPRLHAIFDKGPEIGVTSALLDDSVIDDENALKTEVDNLYVIPAGPIPPNPAE
KT                 VLMDCDLR                                                     
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLHSDRFKALLRKLQGRFDRVIIDSPPIGAVTDGAVLSTLVDGTVLVVRASATTHDFARHGIRALLDVGGQTVGVVLNAA
LLHSDRFKALLRKLQGRFDRVIIDSPPIGAVTDGAVLSTLVDGTVLVVRASATTHDFARHGIRALLDVGGQTVGVVLNAA
                    VIIDSPP                                                     
       730       740       750       760  
....:....|....:....|....:....|....:....|..
DLNRREYGAYHYYGDKREGYYRTPDEPTPPDPADAPPPPLPN
DLNRREYGAYHYYGDKREGYYR                    
      YGAYHYYGDKREGYY                     

© 1998-2019