BYKdb

Annotate results for A0A150W8N4

A0A150W8N4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150W8N4
DOMAINcd51/231TSASKEEGKSTTSANMAIVFAESGKKVLLVDADMRKPTLHHTFHLNNHMGLSNLLIGKGE
LEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLIIFDSPPILSVSD
SKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYN
Y
SITE-188/-190GKT
SITEWalker A'78/85LLVDADMR
SITEWalker B158/164IIFDSPP
SITEY Cluster224/231YYSYEYNY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKQTASKRPLARKLVARIKPNSVISEQYRTIRTTINFSLPGNEMKTLLFTSASKEEGKSTTSANMAIVFAESGKKVLLV
                                                  TSASKEEGKSTTSANMAIVFAESGKKVLLV
                                                         GKS                 LLV
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRKPTLHHTFHLNNHMGLSNLLIGKGELEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLIIF
DADMRKPTLHHTFHLNNHMGLSNLLIGKGELEQSVRDSGIQGLELLTSGQIPHNPAELLDSPMLDRLIEKMKERYDLIIF
DADMR                                                                        IIF
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DSPPILSVSDSKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYNY
DSPPILSVSDSKIMANKCDGTVLVVNTGKTEKQSAIKARDSLTTSKAYIVGVVMNNYKLSKDHYYSYEYNY
DSPP                                                           YYSYEYNY
© 1998-2019