BYKdb

Annotate results for A0A150W912

A0A150W912 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150W912
DOMAINcd50/232TSAAPGEGKSTTSANLATVFAQEGKNVLLVDGDMRKPTTHYTFHMPNTIGLSNVLTRQAT
VENAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLIADLKKRYDVVIFDAPPVLSVTD
GQVLANKCDGAILVVNSGTTEKEMAAKAKEAIEASNSKLIGAVLNNFVLAKDSYYYQYYG
NAE
SITEWalker A57/59GKS
SITEWalker A'77/84LLVDGDMR
SITEWalker B157/163VIFDAPP
SITEY Cluster223/228YYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKQLQQTARKVVTYTTPRSFVSEQFRTLRTNVNFASPDVELRSIVVTSAAPGEGKSTTSANLATVFAQEGKNVLLVD
                                                 TSAAPGEGKSTTSANLATVFAQEGKNVLLVD
                                                        GKS                 LLVD
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDMRKPTTHYTFHMPNTIGLSNVLTRQATVENAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLIADLKKRYDVVIFD
GDMRKPTTHYTFHMPNTIGLSNVLTRQATVENAIRPTTIERLDLMTCGPIPPNPAELLASNAMGMLIADLKKRYDVVIFD
GDMR                                                                        VIFD
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
APPVLSVTDGQVLANKCDGAILVVNSGTTEKEMAAKAKEAIEASNSKLIGAVLNNFVLAKDSYYYQYYGNAE
APPVLSVTDGQVLANKCDGAILVVNSGTTEKEMAAKAKEAIEASNSKLIGAVLNNFVLAKDSYYYQYYGNAE
APP                                                           YYYQYY    
© 1998-2019