BYKdb

Annotate results for A0A150Y6F8

A0A150Y6F8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150Y6F8
DOMAINcd40/230TSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLTGRYKISGEMKGLTHFLSGQG
DLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVI
DSAIVSAVCDAAILVISANTISYKFARSVKDQLAKTGCNILGVVLNKVSMKQNKYYGKYY
GKYYGHYGSDK
SITEWalker A47/49GKS
SITEWalker A'67/74LFIDADLR
SITEWalker B148/154IIIDTPP
SITE-145/-147YDY
SITEY Cluster214/226YYGKYYGKYYGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEIALNLKSMQDYRINESYKQLRTNIEFSGEENKIIAVTSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLTG
                                       TSCTPSEGKSTVSLSTAYSLAEAGKKVLFIDADLRKSVLTG
                                              GKS                 LFIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKISGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
RYKISGEMKGLTHFLSGQGDLSEILCKTNEKGLFVIFAGPVPPNPAELLGSKKFAALLKEARNIYDYIIIDTPPLGSVID
                                                                   IIIDTPP      
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIVSAVCDAAILVISANTISYKFARSVKDQLAKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDK
SAIVSAVCDAAILVISANTISYKFARSVKDQLAKTGCNILGVVLNKVSMKQNKYYGKYYGKYYGHYGSDK
                                                     YYGKYYGKYYGHY    
© 1998-2019