BYKdb

Annotate results for A0A150Y6N2

A0A150Y6N2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A150Y6N2
DOMAINcd298/487TSTMPEEGKSTLAYNLAAAAASHGVKVLFVDADLRKQEDRKHLTGEIGRGLASVVTGKCT
LEEAVRNEEETGIDFLGGSRPIKKVQQILNHSRFEAVLQEMKERWDLIILDAPPAEMFED
ASILAERADGILYIIRYDMVQKRRILDCIQGLEDAKAPLLGYAFNGIPVHRGGYGYYGYG
RYGYGYYGYG
SITEWalker A305/307GKS
SITEWalker A'325/332LFVDADLR
SITEWalker B405/411IILDAPP
SITE-430/-434YIIRY
SITEY Cluster471/491YGYYGYGRYGYGYYGYGSYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEKNGYQKVDSGSYRKLDGDDVIDLGTLFWNIIQGFLKFWWLVILLMAIGAGAFYLKASRIFYMPMYQSSATFTVLTGG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASTADSGNGTYNFYYDTTTAGQLARTFPYILSSSLLTDAIKEDLGVEAVNGSISAQAISESNMITMSVISQSPEDAKAIL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESAIKVYPDIARFVIGDTRFNIIDEPTMPDEPYNKPSYRAQIKKGGLYGAGAGILLICLYAFFKKTVQKPEELKSAMSLT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CIANIPEAPRKLRKQKDQRWIRMKDDRTPQAFKENIQSLQIRISRELEERGGKLLLITSTMPEEGKSTLAYNLAAAAASH
                                                         TSTMPEEGKSTLAYNLAAAAASH
                                                                GKS             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVKVLFVDADLRKQEDRKHLTGEIGRGLASVVTGKCTLEEAVRNEEETGIDFLGGSRPIKKVQQILNHSRFEAVLQEMKE
GVKVLFVDADLRKQEDRKHLTGEIGRGLASVVTGKCTLEEAVRNEEETGIDFLGGSRPIKKVQQILNHSRFEAVLQEMKE
    LFVDADLR                                                                    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RWDLIILDAPPAEMFEDASILAERADGILYIIRYDMVQKRRILDCIQGLEDAKAPLLGYAFNGIPVHRGGYGYYGYGRYG
RWDLIILDAPPAEMFEDASILAERADGILYIIRYDMVQKRRILDCIQGLEDAKAPLLGYAFNGIPVHRGGYGYYGYGRYG
    IILDAPP                                                           YGYYGYGRYG
       490       500 
....:....|....:....|.
YGYYGYGSYSYEDRKKRGAHD
YGYYGYG              
YGYYGYGSYSY          
© 1998-2019