BYKdb

Annotate results for A0A151A3H8

A0A151A3H8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151A3H8
DOMAINcd47/228TSEKPISGKSTITANIAVTYAQAGFKTLIIDGDMRKPTQHYIFDINNNYGLSNLIINKAT
YSESIKETKVENLAVLTSGPTPPNPSELIASNNFNNIYNELLNHYDFIVIDTPPINTVTD
AQIYAQIVGNCALVIDAEKNNRNEVKKAKDLIGKSSGKLIGAILNKMPFDKTSSYYYYYG
ED
SITE-199/-201GKS
SITEWalker A'74/81LIIDGDMR
SITEWalker B154/160IVIDTPP
SITEY Cluster221/225YYYYY
SITEWalker A54/56GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKRTVSPLYVHDKPKSTISEKFRGIRSNIMFSNPENEISSLLVTSEKPISGKSTITANIAVTYAQAGFKTLIIDGDM
                                              TSEKPISGKSTITANIAVTYAQAGFKTLIIDGDM
                                                     GKS                 LIIDGDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTQHYIFDINNNYGLSNLIINKATYSESIKETKVENLAVLTSGPTPPNPSELIASNNFNNIYNELLNHYDFIVIDTPP
RKPTQHYIFDINNNYGLSNLIINKATYSESIKETKVENLAVLTSGPTPPNPSELIASNNFNNIYNELLNHYDFIVIDTPP
R                                                                        IVIDTPP
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
INTVTDAQIYAQIVGNCALVIDAEKNNRNEVKKAKDLIGKSSGKLIGAILNKMPFDKTSSYYYYYGED
INTVTDAQIYAQIVGNCALVIDAEKNNRNEVKKAKDLIGKSSGKLIGAILNKMPFDKTSSYYYYYGED
                                                            YYYYY   
© 1998-2019