BYKdb

Annotate results for A0A151A429

A0A151A429 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151A429
DOMAINcd45/228TSEKPLSGKTTISSNIGVTYAQAGYRTLIIDGDMRKPSQHYVFNLSNSAGLSNLIINKAT
YKEAIKSTEIENLHVLTSGIVPPNPSELIGSKRFIEIYKTLEEIYDFIIIDTPPINAVTD
AQLFAQVAKHSILVIDVQRNDRDEVKKAKDLLDAAGAKIIGAILNKASLDNTSDYYYYYG
KDKQ
SITEWalker A52/54GKT
SITEWalker A'72/79LIIDGDMR
SITEWalker B152/158IIIDTPP
SITE-64/-69YAQAGY
SITEY Cluster219/223YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKTVKNTSNLFVHHNPKSVISEKFKTIRSNIMFSNATKSILITSEKPLSGKTTISSNIGVTYAQAGYRTLIIDGDMRK
                                            TSEKPLSGKTTISSNIGVTYAQAGYRTLIIDGDMRK
                                                   GKT                 LIIDGDMR 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSQHYVFNLSNSAGLSNLIINKATYKEAIKSTEIENLHVLTSGIVPPNPSELIGSKRFIEIYKTLEEIYDFIIIDTPPIN
PSQHYVFNLSNSAGLSNLIINKATYKEAIKSTEIENLHVLTSGIVPPNPSELIGSKRFIEIYKTLEEIYDFIIIDTPPIN
                                                                       IIIDTPP  
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
AVTDAQLFAQVAKHSILVIDVQRNDRDEVKKAKDLLDAAGAKIIGAILNKASLDNTSDYYYYYGKDKQ
AVTDAQLFAQVAKHSILVIDVQRNDRDEVKKAKDLLDAAGAKIIGAILNKASLDNTSDYYYYYGKDKQ
                                                          YYYYY     
© 1998-2019