BYKdb

Annotate results for A0A151AK51

A0A151AK51 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151AK51
DOMAINcd38/224TSSGPSEGKSTTTGNLALTMAQSDKKVLIVDCDLRKPTVHKKFSISNEKGLSNYLIGEVE
LDDVIVKYSENLYLLTSGTIPPNPAEMLSSKKMKEFLDLMKEKFDTVIIDSPPVLAVTDA
QILSTEVEGVLLVAASGQTEKEALIRAKELLLKVKANILGVILTRVPQDSGKGGYTYYYY
YGDGDDN
SITEWalker A45/47GKS
SITEWalker A'65/72LIVDCDLR
SITEWalker B144/150VIIDSPP
SITE-105/-110YSENLY
SITEY Cluster212/218YTYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVEKEPKSIAAEAYRTLRTNIQYSSFDKDIKTILVTSSGPSEGKSTTTGNLALTMAQSDKKVLIVDCDLRKPTVHKKF
                                     TSSGPSEGKSTTTGNLALTMAQSDKKVLIVDCDLRKPTVHKKF
                                            GKS                 LIVDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SISNEKGLSNYLIGEVELDDVIVKYSENLYLLTSGTIPPNPAEMLSSKKMKEFLDLMKEKFDTVIIDSPPVLAVTDAQIL
SISNEKGLSNYLIGEVELDDVIVKYSENLYLLTSGTIPPNPAEMLSSKKMKEFLDLMKEKFDTVIIDSPPVLAVTDAQIL
                                                               VIIDSPP          
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
STEVEGVLLVAASGQTEKEALIRAKELLLKVKANILGVILTRVPQDSGKGGYTYYYYYGDGDDNHKKRRKKK
STEVEGVLLVAASGQTEKEALIRAKELLLKVKANILGVILTRVPQDSGKGGYTYYYYYGDGDDN        
                                                   YTYYYYY              
© 1998-2019