BYKdb

Annotate results for A0A151B3D9

A0A151B3D9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151B3D9
DOMAINcd38/225TSTSPYEGKSVTVSNLAVSMVQDGKKVLIVDCDLRRPTIHKKFGISNLNGLSNYLVGEIS
FEDAIVERGENLYIMSSGIVPPNPSEMLSSNKMKEFLNFKRDEFDLIILDSPPVLAVTDA
QVLSTMVDGVILVVESGKTEKEALVKSKEHLDKVKANIIGVVINKIPVNKGKGYGYYYYY
YYEHEKDY
SITE-174/-176GKT
SITEWalker A'65/72LIVDCDLR
SITEWalker B144/150IILDSPP
SITEY Cluster211/225YGYYYYYYYEHEKDY
SITEWalker A45/47GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVEKNPKSYISEAYRTLRTNIKYSSYDDEIKSILITSTSPYEGKSVTVSNLAVSMVQDGKKVLIVDCDLRRPTIHKKF
                                     TSTSPYEGKSVTVSNLAVSMVQDGKKVLIVDCDLRRPTIHKKF
                                            GKS                 LIVDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GISNLNGLSNYLVGEISFEDAIVERGENLYIMSSGIVPPNPSEMLSSNKMKEFLNFKRDEFDLIILDSPPVLAVTDAQVL
GISNLNGLSNYLVGEISFEDAIVERGENLYIMSSGIVPPNPSEMLSSNKMKEFLNFKRDEFDLIILDSPPVLAVTDAQVL
                                                               IILDSPP          
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
STMVDGVILVVESGKTEKEALVKSKEHLDKVKANIIGVVINKIPVNKGKGYGYYYYYYYEHEKDYRKRRKRSVK
STMVDGVILVVESGKTEKEALVKSKEHLDKVKANIIGVVINKIPVNKGKGYGYYYYYYYEHEKDY         
                                                  YGYYYYYYYEHEKDY         
© 1998-2019