BYKdb

Annotate results for A0A151BT98

A0A151BT98 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151BT98
DOMAINcd255/443TSARPGDGKTTVAANLALAMARDGYRTVLVDGDLRKPGVGSAIGIDGSVGLTNVLVHEVG
LKDVLVEPEPSLPLFVLPAGPVPPNASELLGSSAMQGLFQELVAEFDFVVFDSPPMLPVV
DALELEKLTGNLILVARGGQVSRRELQITLKALETVDANLSGTVLNYADHFSDDYGYGSK
YGYGEQEMA
SITEWalker A262/264GKT
SITEWalker A'282/289VLVDGDLR
SITEWalker B363/369VVFDSPP
SITEY Cluster429/437YGYGSKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTIRDFLRIMRQRWRWLLGTLLVVLAVAAVSTLMQPKTYEASARFYLAGSNGQGTPVQRDDLATYAQVVSAPAVQKVIRQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAKLGPSVPVTVSATLSDTANIMTATASSGSAQEAAAIANATGPALAAVAPQFSQLLSGAGSVTSTAVQPAEVPASPASP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLKKALELALAVGLLLGVAMALLRHFMDNRVRTVEDLETLVQRPVLSIVPRVGGGHRVVDTSDHPSGAMVEAMRRLRTNV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFVNVTNDVPAVVVTSARPGDGKTTVAANLALAMARDGYRTVLVDGDLRKPGVGSAIGIDGSVGLTNVLVHEVGLKDVLV
              TSARPGDGKTTVAANLALAMARDGYRTVLVDGDLRKPGVGSAIGIDGSVGLTNVLVHEVGLKDVLV
                     GKT                 VLVDGDLR                               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPEPSLPLFVLPAGPVPPNASELLGSSAMQGLFQELVAEFDFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRREL
EPEPSLPLFVLPAGPVPPNASELLGSSAMQGLFQELVAEFDFVVFDSPPMLPVVDALELEKLTGNLILVARGGQVSRREL
                                          VVFDSPP                               
       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
QITLKALETVDANLSGTVLNYADHFSDDYGYGSKYGYGEQEMAASGRTRSRRSDKRG
QITLKALETVDANLSGTVLNYADHFSDDYGYGSKYGYGEQEMA              
                            YGYGSKYGY                    
© 1998-2019