BYKdb

Annotate results for A0A151BXD8

A0A151BXD8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151BXD8
DOMAINtad1/135MRIDEYYRILRRHWKVIIAATLAAIAVMFVWDLFQPRVYQASSSGYVTAGPSQNLSEASF
GDQLAKSRATSYVDVAQSRAVAERVIDDLNLQTTPAALINQISVEQPTDTVLLRISANAS
SPEQAQAIANAWVKA
DOMAINcd273/462SSPNPDDGKSTVAANIAASVALSGERTLLVDADLRRPSVATGFGLLDGAGLAEVLAHRVD
LADVLQEAPETPNLSVLAAGLTPPNPSEMVGSKAMKALLDDLSQEYFVVIDAPPLLPVTD
AAILGTQVDGVVVVITAGKTLDHQLETSLRSLREVHADILGVVMNKLTQRDMQSYYGSGY
GTYYGREVAA
SITE-410/-412GKT
SITEWalker A'300/307LLVDADLR
SITEWalker B380/386VVIDAPP
SITEY Cluster447/456YYGSGYGTYY
SITEWalker A280/282GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRIDEYYRILRRHWKVIIAATLAAIAVMFVWDLFQPRVYQASSSGYVTAGPSQNLSEASFGDQLAKSRATSYVDVAQSRA
MRIDEYYRILRRHWKVIIAATLAAIAVMFVWDLFQPRVYQASSSGYVTAGPSQNLSEASFGDQLAKSRATSYVDVAQSRA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAERVIDDLNLQTTPAALINQISVEQPTDTVLLRISANASSPEQAQAIANAWVKALAAQVKQIEGSSANSLRVDVVDPAQ
VAERVIDDLNLQTTPAALINQISVEQPTDTVLLRISANASSPEQAQAIANAWVKA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPSSPVSPNTKLDLIIAGIVGLLAGIGLAMVRSQMDGRLRDPNKVREQFGVPVLGSVPQNSQLSKSEQRIPIVVGEGVRT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTEGLITAEAFLKMRTSLQYMNVDRTLRVIVVSSPNPDDGKSTVAANIAASVALSGERTLLVDADLRRPSVATGFGLLDG
                                SSPNPDDGKSTVAANIAASVALSGERTLLVDADLRRPSVATGFGLLDG
                                       GKS                 LLVDADLR             
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGLAEVLAHRVDLADVLQEAPETPNLSVLAAGLTPPNPSEMVGSKAMKALLDDLSQEYFVVIDAPPLLPVTDAAILGTQV
AGLAEVLAHRVDLADVLQEAPETPNLSVLAAGLTPPNPSEMVGSKAMKALLDDLSQEYFVVIDAPPLLPVTDAAILGTQV
                                                           VVIDAPP              
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGVVVVITAGKTLDHQLETSLRSLREVHADILGVVMNKLTQRDMQSYYGSGYGTYYGREVAAPSTQRGSRERALRRQRSK
DGVVVVITAGKTLDHQLETSLRSLREVHADILGVVMNKLTQRDMQSYYGSGYGTYYGREVAA                  
                                              YYGSGYGTYY                        
 
.
K


© 1998-2019