BYKdb

Annotate results for A0A151C1L8

A0A151C1L8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151C1L8
DOMAINtad1/134MDLSAAVRTLRKRWQLLSLLALLGVALAAAITTQIPAVYASKVTFYVATPPSTTSSLFDA
SQFGTQRVNSYVKLLSSDELAARIVADQHLTDDPHQLATRISGTADLNTVLMTAQATGDS
PAHAQQLAAGIKVA
DOMAINcd264/451SSAVSGDGKTTMSVDLAAAFGETGQRTLLVDADLRRGRVAEYLKIDGSIGLSDVLANRIG
LDDVLTETPAHLWVLPSGTVPPNPVELLDSRHMTSVIQDLADRFDVVIIDTPPVIPVTDG
VVVASKCDGVILVARHGVTKRAQIAQATSAINAVRAQCIGWILNQVPRTRKDRSYYSYAS
TNPTRHAD
SITEWalker A271/273GKT
SITEWalker A'291/298LLVDADLR
SITEWalker B370/376VIIDTPP
SITEY Cluster438/441YYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLSAAVRTLRKRWQLLSLLALLGVALAAAITTQIPAVYASKVTFYVATPPSTTSSLFDASQFGTQRVNSYVKLLSSDEL
MDLSAAVRTLRKRWQLLSLLALLGVALAAAITTQIPAVYASKVTFYVATPPSTTSSLFDASQFGTQRVNSYVKLLSSDEL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AARIVADQHLTDDPHQLATRISGTADLNTVLMTAQATGDSPAHAQQLAAGIKVAMPPLVQDLDVTPASKTPSVDLTVVTG
AARIVADQHLTDDPHQLATRISGTADLNTVLMTAQATGDSPAHAQQLAAGIKVA                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTPAIQIAPNKKVNYGLGLLLGLGVGIAWALLRELTDTSVKSTAQLSEVSGQAVLGTASLAAKGASPLMPDNDGYNPLTE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EIRQIRTNLQFVNVDRPPRVIAVSSAVSGDGKTTMSVDLAAAFGETGQRTLLVDADLRRGRVAEYLKIDGSIGLSDVLAN
                       SSAVSGDGKTTMSVDLAAAFGETGQRTLLVDADLRRGRVAEYLKIDGSIGLSDVLAN
                              GKT                 LLVDADLR                      
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RIGLDDVLTETPAHLWVLPSGTVPPNPVELLDSRHMTSVIQDLADRFDVVIIDTPPVIPVTDGVVVASKCDGVILVARHG
RIGLDDVLTETPAHLWVLPSGTVPPNPVELLDSRHMTSVIQDLADRFDVVIIDTPPVIPVTDGVVVASKCDGVILVARHG
                                                 VIIDTPP                        
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTKRAQIAQATSAINAVRAQCIGWILNQVPRTRKDRSYYSYASTNPTRHADHLTDKTEHASKGVTAAPDRPTQDAGPVGK
VTKRAQIAQATSAINAVRAQCIGWILNQVPRTRKDRSYYSYASTNPTRHAD                             
                                     YYSY                                       
      
....:.
GSKGSS


© 1998-2019