BYKdb

Annotate results for A0A151C7E4

A0A151C7E4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151C7E4
DOMAINtad1/138MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQS
SSAAASSAAAQLANYIEVVQSDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITV
TYPNAKDTTLILNEVAKQ
DOMAINcd271/458TSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVGLVKLLAGDVD
ARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDA
SVFARSGGTVLLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYE
ESEVKNRR
SITEWalker A278/280GKT
SITEWalker A'298/305LLIDADAR
SITEWalker B377/383VIIDTAP
SITEY Cluster446/449YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ
MTVADLFRAIKRHWILEIILFVVTVGAVAGFTFTATPMYSAQIQLMPKATASADASTAQSSSAAASSAAAQLANYIEVVQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQLNKQVSADASDMLTLTTVQKPV
SDAVLQPTIDNLGLHETVPQLRKLVVAENVTGTTLLDITVTYPNAKDTTLILNEVAKQ                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPTLPSSPNIIANMAIGVVAALVVAVLGAFLRELADNNIHAQTDITNAVNAPILASIPKSFTVAGHVPAVIVKPRGHAAE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFRRLCTNLSFVENGNKDRPDNDHSNVIIVTSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
                              TSAVPGEGKTSVSVNLAAVYAEKGESVLLIDADARHPSVAKALGLNNAVG
                                     GKT                 LLIDADAR               
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
LVKLLAGDVDARTAVQRYWKPEMQVLPVEETSTSNVILGSNVMRDMVDQATRHYDHVIIDTAPIQVSNDASVFARSGGTV
                                                        VIIDTAP                 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYEESEVKNRRTKASTGDSSQNSASRNARRGRR
LLVVSQNVGQKKALRNTVRELKVAHVRIGGVAFNRVAHERSRKSNYYYYEESEVKNRR                      
                                             YYYY                               
      
....:.
TTADGR


© 1998-2019