BYKdb

Annotate results for A0A151FTD4

A0A151FTD4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A151FTD4
DOMAINtad22/197PFQSLTLHLDVVRHQFPTIVAIISASVILALLYLFTEAPQFTSTASIVIDTRKVQLFQQQ
SMLGDVAPDSASVETQVEILKSENISLAVIRDLHLTEDPEFLGNGGSLIGSIGNFFSDLF
SSGRAGSEFRLQRKALQRFESNRTIKRLGLTYVMEIGFTSRDPAKAAQIANAIADA
DOMAINcd543/734TSTLPNEGKSTLSANLAQLMAHGGARVLLIDCDLRNPSLSRALTPDAEFGLVEILAHKAK
LEQALTVDAQTGLSILAAGTTSKLLHTNEILASKMMHGLIGELRDKFDYIVLDMPPMAPV
VDVRVTSTFVDSYVFVVEWGKTLMDVVRHNLRGSQEIQDKLLGVVLNKADTKRLARYESY
HSRYYYKKNYAR
SITE-682/-684GKT
SITEWalker A'570/577LLIDCDLR
SITEWalker B652/658IVLDMPP
SITEY Cluster719/737YESYHSRYYYKKNYARYGY
SITEWalker A550/552GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQLNKSTSEINREFAETQGSPFQSLTLHLDVVRHQFPTIVAIISASVILALLYLFTEAPQFTSTASIVIDTRKVQLFQQ
                     PFQSLTLHLDVVRHQFPTIVAIISASVILALLYLFTEAPQFTSTASIVIDTRKVQLFQQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSMLGDVAPDSASVETQVEILKSENISLAVIRDLHLTEDPEFLGNGGSLIGSIGNFFSDLFSSGRAGSEFRLQRKALQRF
QSMLGDVAPDSASVETQVEILKSENISLAVIRDLHLTEDPEFLGNGGSLIGSIGNFFSDLFSSGRAGSEFRLQRKALQRF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESNRTIKRLGLTYVMEIGFTSRDPAKAAQIANAIADAYIVDQLEAKYQSTRRASVWLQDRIKELRAQASAAQKAVVDFKT
ESNRTIKRLGLTYVMEIGFTSRDPAKAAQIANAIADA                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANNIVDTGGRLMNEQQLAEVNSQLVGAHASTAEARARLDRINDILKREIPDAAVADALRNETIVKLRGQYVDMAAKEAIW


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAKYGHDHLAAVNLRRQMDEIKRNMIDELKRIQESYKSDYDIAVTREESIKASLATVVSESQLTNQAQVRLRELDSNAQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQAMYDNFLQRYMESVQQQSFPISEARVISAATTPLVKSYPKTLIVLGVALFGGLVLSFVLAIVREMMDRVFRTTQQVEE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLGASCIALLPTVNAAATKDARPKLLRYVVDHPLSRFSEAVRSTKVAVDLNSIVRENRVLAVTSTLPNEGKSTLSANLAQ
                                                              TSTLPNEGKSTLSANLAQ
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LMAHGGARVLLIDCDLRNPSLSRALTPDAEFGLVEILAHKAKLEQALTVDAQTGLSILAAGTTSKLLHTNEILASKMMHG
LMAHGGARVLLIDCDLRNPSLSRALTPDAEFGLVEILAHKAKLEQALTVDAQTGLSILAAGTTSKLLHTNEILASKMMHG
         LLIDCDLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIGELRDKFDYIVLDMPPMAPVVDVRVTSTFVDSYVFVVEWGKTLMDVVRHNLRGSQEIQDKLLGVVLNKADTKRLARYE
LIGELRDKFDYIVLDMPPMAPVVDVRVTSTFVDSYVFVVEWGKTLMDVVRHNLRGSQEIQDKLLGVVLNKADTKRLARYE
           IVLDMPP                                                            YE
       730         
....:....|....:....
SYHSRYYYKKNYARYGYVD
SYHSRYYYKKNYAR     
SYHSRYYYKKNYARYGY  

© 1998-2019