BYKdb

Annotate results for A0A151G3Z0

A0A151G3Z0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A151G3Z0
DOMAINcd53/240TSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGLSSWLANQMD
DVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLVIVDAPPILPVTD
SQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNS
GYGYYSDE
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADLR
SITEWalker B160/166VIVDAPP
SITEY Cluster227/237YYGYNSGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKRKEQNITTTAPINLTTINEPMSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVL
                                                    TSAMLGEGKSTVSGNLAVEYAKEGMQVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
LVDADLRRPTIHKTFGLKNHKGLSSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRKLDLV
LVDADLR                                                                        V
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNSGYGYYSDE
IVDAPPILPVTDSQLLANKVDGTVLVVRQGVAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNSGYGYYSDE
IVDAPP                                                            YYGYNSGYGYY   
  
..
DK


© 1998-2019